KEGG   Thermobifida fusca: Tfu_0969Help
Entry
Tfu_0969          CDS       T00265                                 

Definition
(GenBank) hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1136456..1136680
Genome map
AA seq 74 aa AA seqDB search
MFGKRRRDVLPTPEDGEDKWWYSLKTGKVERGPGSPTKDRLGPYPDRASAEAALERARQR
NEQWEEEDREWNEW
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggtaaacggcgccgggatgtccttcccaccccggaggacggggaggacaagtgg
tggtattcgctgaagacggggaaggtggagcgcggcccgggcagtccgacgaaggaccgg
ctcggcccatacccggaccgggcgtccgctgaggcggcgttggagcgggcccgccagcgc
aacgagcagtgggaggaagaggaccgcgagtggaacgagtggtga

DBGET integrated database retrieval system