KEGG   Thermobifida fusca: Tfu_0970Help
Entry
Tfu_0970          CDS       T00265                                 

Definition
(GenBank) reduced coenzyme F420:NADP oxidoreductase
  KO
K06988  
8-hydroxy-5-deazaflavin:NADPH oxidoreductase [EC:1.5.1.40]
Organism
tfu  Thermobifida fusca
Brite
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.40  8-hydroxy-5-deazaflavin:NADPH oxidoreductase
     Tfu_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1136729..1137427
Genome map
AA seq 232 aa AA seqDB search
MIMIMASKSSPHDLPDVSGLSIAVLGGTGDQGRGLARRFAMAGHEVILGSRSAERAQAVA
AELGEGLPVRGMDNAGAAEAGDVVIVAVPWDGHRALLESLKDVLAGKIVVDCVNPLGFDK
RGAYALPVEEGSAAEQAAAILPDSRVVAAFHHVSAVLLLDPEVEKVDLDVLVLGDDREAT
DVVRALAARIPGVRGVYGGRLRNAHQVEAFTANLISINRRYKAHAGIRITDI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgattatggcatcgaagagttctccgcacgatcttcctgacgtctctggcctg
tcgattgccgtgctggggggcacgggtgatcagggccgcggcttggcgcgccggttcgcg
atggccgggcacgaggtgattctcggttcgcggagcgcggagcgggcccaggcggttgcc
gccgagttgggcgagggcttgccggtccgcggcatggacaacgcgggcgcggccgaggcc
ggggacgtggtgatcgtggcggttccgtgggacggtcaccgtgccctgctggagtcgttg
aaggatgtgctggcgggcaagatcgtcgtcgactgtgtgaacccgctgggtttcgacaag
cgcggcgcgtatgcgctgccggttgaggaggggagcgctgccgagcaggctgccgcgatc
ctgccggacagccgcgtggtggccgcgttccaccacgtgtccgccgtgcttttgctggac
cccgaggtcgagaaggtggatttggacgtgctcgtgctcggggacgaccgtgaagccacc
gatgttgtgcgcgctttggcggcccgtatccccggggtgcggggagtttacggcgggcgc
ctgcgcaacgcccaccaggtggaggcgttcaccgccaacctgatttcgatcaaccgccgt
tacaaggcccacgcgggtatccgcatcaccgacatctaa

DBGET integrated database retrieval system