KEGG   Thermobifida fusca: Tfu_0974Help
Entry
Tfu_0974          CDS       T00265                                 

Definition
(GenBank) helix-turn-helix motif
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1142886..1143740)
Genome map
AA seq 284 aa AA seqDB search
MQRSYSPTIRRRRISAQLRKFRKQKGLSAAAVGEKLGWPQQKISKIESGEQKRIPAAELD
ALLEVYGVTDPQIRESLHECARLAKERGWWTRYKDAFPSGLPDFESEASVIRSYECQVIP
GILQTPDYADAIFRAYKLREDKEIDRLVKARMERQNILNRVDPPHFMTIIDEAALHRLVG
SVEVMRTQLRHLTHMASRHNIDIYVLPFKAGAHAATTGSFMIMDFPDPMDNSIVYVDTPT
SILYIEDEEEVREFNVMFSRTQSAALSPTLSMDLVKKVIKSLEE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggagctacagtccgaccatccgccgacggcggatctctgcacagttacggaag
ttccgcaagcagaagggactctcggcagccgcagtaggtgagaagctgggctggccacag
cagaagatctccaagatcgagagcggcgaacaaaagagaatcccagcggccgagctcgac
gctctcctagaggtctacggtgtcaccgaccctcagatacgcgagtccttgcacgagtgc
gcccgccttgccaaggaacgcggttggtggaccaggtacaaggacgctttccctagcggt
cttccagacttcgagagcgaagcttccgtcatccgctcctatgagtgtcaggtcatcccc
ggcatactccaaacacccgactatgccgacgcaatcttccgggcctacaaactccgcgaa
gacaaggagatcgatcgtctagtcaaggcccgcatggaacggcagaacatcctcaaccgg
gtcgatccgccacacttcatgaccatcatcgatgaggcagcgctccatcgcctcgtcggt
tcggttgaggtcatgcgcacccagcttcgtcatctgactcacatggcttcccggcacaac
atcgacatctacgtgctgccgttcaaggcgggggcgcatgccgcaaccaccggaagtttc
atgatcatggacttccccgacccaatggacaacagcatcgtctacgtcgacaccccgact
tctatcctgtacatcgaagatgaagaggaagtcagggagttcaacgtgatgttcagccgt
acccagtcggcggcgttgagcccgacactgtcgatggacctggtcaaaaaagttatcaag
tcactagaagagtga

DBGET integrated database retrieval system