KEGG   Thermobifida fusca: Tfu_0988Help
Entry
Tfu_0988          CDS       T00265                                 

Definition
(GenBank) L-glutamine synthetase
  KO
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
tfu  Thermobifida fusca
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tfu_0988
  Energy metabolism
   00910 Nitrogen metabolism
    Tfu_0988
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tfu_0988
   00220 Arginine biosynthesis
    Tfu_0988
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tfu_0988
Enzymes [BR:tfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     Tfu_0988
Exosome [BR:tfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tfu_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1159703..1161127)
Genome map
AA seq 474 aa AA seqDB search
MFSNADEALAYIRTEGVQFVDVRFTDLFGGVHHVTLPAEKVDEDFLTNGQMFDGSSIRGF
QAIHESDMLLLPDLSTAVLDPFREYKTLNITFFVHDPLTRESYSRDPRNVARKAEAYLKS
TGIADTAYFGPEAEFYIFDDVQFATAPNTGFYAIDSVEGAWNTGSKREGGNLGYRPRYKG
GYFPVEPSDHYSDLRSRMVRTMIEVGLPVELHHHEVGTAGQSEIGIKFGTLLQQADRVQL
YKYIVKNVANAAGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLFFDENGYAQLSDIARY
YIGGLLKHAPSLLAFTNPTINSYHRLVPGYEAPINLVYSQRNRSACIRIPLTGSDPKAKR
LEFRVPDPSANPYLAFSAMLMAGIDGIQNKIEPPEPLDKDLYELPPEEAAEIEKVPASLE
EALDHLEEDHEYLVEGGVFTEDLIETYINYKRTVEIDSVRLRPHPREFELYYDV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgttcagcaacgctgacgaggctcttgcctatatccgcaccgaaggcgttcagttcgtg
gacgtccggttcaccgacctgttcggtggtgtccaccacgtgacgcttccggccgagaag
gttgacgaggacttcctcacgaacgggcagatgttcgacggctcgtcgatccgcggcttc
caggcgatccacgagtccgacatgctgctcctgccggacctgagcaccgctgtcctcgac
cccttccgcgaatacaagacgctgaacatcacgttcttcgtgcacgacccgctgacccgc
gagtcctacagccgcgacccgcggaacgtggcccgcaaggccgaggcgtatctgaagagc
acggggatcgcggacaccgcgtacttcggcccggaagccgagttctacattttcgacgac
gtccagttcgcgaccgcgccgaacaccggtttctacgcgatcgactcggtggagggcgcg
tggaacaccggcagcaagcgggagggcggcaacctcggctaccggccgcgctacaagggt
ggctacttcccggtggagccgagcgaccactacagcgacctgcggtcccgcatggtgcgc
accatgatcgaggtggggctgccggtggagctgcaccaccacgaggtgggcacggcgggc
cagtcggagatcggcatcaagttcggcacgctgctgcagcaggctgaccgggtccagttg
tacaagtacatcgtcaagaacgtggcgaacgcggcgggcaagacggtgacgttcatgccg
aagccgctgttcggcgacaacggctcggggatgcactgccaccagagcctgtggaaggac
ggcgctcccctgttcttcgacgagaacgggtacgcgcagttgtccgacatcgcccgctac
tacatcggcggcctgttgaagcacgccccgtcgctgctggcgttcaccaacccgacgatc
aactcctaccaccgcctggtgcccggctacgaggcgccgatcaacctggtgtactcgcag
cggaaccgttccgcgtgcatccgtatcccgctgaccgggtctgacccgaaggcgaagcgg
ctggagttccgggtgccggacccgtcggccaacccgtacctggcgttctccgcgatgctg
atggcggggatcgacgggatccagaacaagatcgagccgccggagccgctggacaaggac
ctctacgagctgccgccggaggaggccgcggagatcgagaaggtgccggcgtcgctggag
gaggcgctggaccacttggaggaggaccacgagtacctggtggagggcggtgtcttcacc
gaggacttgatcgagacgtacatcaactacaagcgcacggtggagatcgactcggtccgg
ctgcgtccgcacccgcgcgagttcgagctctactacgacgtctga

DBGET integrated database retrieval system