KEGG   Thermobifida fusca: Tfu_0993Help
Entry
Tfu_0993          CDS       T00265                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tfu  Thermobifida fusca
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tfu_0993
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tfu_0993
  Amino acid metabolism
   00310 Lysine degradation
    Tfu_0993
Enzymes [BR:tfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tfu_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1164750..1166492)
Genome map
AA seq 580 aa AA seqDB search
MSTPVTMPDLGESVTEGTVTQWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPVSGVLTKIL
VGEDETVEVGAQIAIITPAGEAPPAQPAPETAAEPAAQPEPEPEPAPQPAAEARTEPAAP
VADAGAATPVTMPNLGESVSEGTVTQWLKQEGDTVEADEPLLEVSTDKVDTEIPSPVSGV
LTKILVGEDETVEVGAQIALISPAGQAAAPAAPAAPQPAPEPKPEARPEPAPQPAAQPEA
AARTEPAPQPRRTRDDETPTVDLETISGTGQVLGTDATSEGYVTPLVRKLAAQEGVDLSQ
VKGTGVGGRIRKQDVLEAARRMREQRQRAAAAPAPAAADTALRGRTETMSRLRQTFAEQI
VESLHTAAQLTQVVEVDVTAIARLREQVGERFAAETGVELGFFPFFALAVVEALQRHPKL
NAVIDGTEVTYHDTENLAVVVDTEQGVLAPVVKDAGRLSLRELARRIDDLGARARTARLV
PDELSGGTFTMVDSGAYGALVETPIIHQPQVAVLSTGTVVKRPVVVEEPQLGEVITVRSM
VYLSLSFDHRLIDGADAARFLSDVKRRLEEGAFEDAVGLK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcccgttaccatgcccgatctgggcgaaagcgtcaccgagggcactgtcacc
caatggctcaagcaggagggcgacacggtcgaggtcgacgagccgctgctcgaagtctcg
acagacaaggttgacaccgaaatcccctcccccgtctccggtgtcttgacgaagatcctg
gtcggcgaagacgagactgttgaggtcggcgcgcagatcgcgatcatcactccggctggg
gaggcgccgccggctcagcccgctcccgagacggcggctgagccggcggcccagccggaa
ccggagccggagcctgctccgcagcctgccgcggaggcccgcaccgagcccgctgctccg
gtggctgacgccggtgccgctaccccggtgaccatgccgaacttgggggagagtgtcagc
gagggcacggtcacccagtggctgaagcaggagggcgacacggtcgaggccgacgagccg
ctgctcgaagtctcgacagacaaggttgacaccgaaatcccctcccccgtctccggtgtc
ttgacgaagatcctggtcggcgaagacgagactgttgaggtcggcgcgcagatcgcgctg
atcagtcctgccgggcaggctgctgcgcctgctgccccggcggctccgcagcccgcaccc
gagccgaagccggaggcacggcccgagcccgcaccgcagcctgctgcgcagccggaagct
gcagcccgcacggagcccgcaccgcagccgcgccgcacccgggacgatgagaccccgacc
gtggacttggagacgatcagcggcaccggccaggtgctgggcacggacgcgaccagtgaa
gggtatgtgaccccgctggtgcggaagcttgccgcccaggagggtgtggacctgtcccag
gtgaagggcaccggggtgggtggccggatccgcaagcaggacgtgttggaggcagcgcgg
cggatgcgggagcagcggcagcgtgctgctgcggcaccggcgcccgcggccgcggacacg
gcgctgcggggccgcacggagacgatgtcgcggctgcggcagacgttcgccgagcagatc
gtcgagtcgctgcacacggcggcgcagctcacccaggtggtggaggtggatgtcaccgcg
atcgcccggctgcgggagcaggtgggcgagcggttcgccgccgagaccggcgtggagttg
ggcttcttcccgttcttcgcgctggccgtggtggaggcgctgcagcggcacccgaagctc
aacgcggtgatcgacggcaccgaggtgacctaccacgacaccgagaacctggcggtggtg
gtcgacaccgagcagggtgtgctggccccggtggtcaaggacgcgggccgcttgtcgctg
cgggagctggcccggcggatcgacgacttgggggcgcgggcgcgcacggcgcggctggtg
ccggacgagttgagcggcggcacgttcaccatggtggacagcggcgcgtacggcgcgctg
gtggagacgccgatcatccaccagccgcaggtggcggtgttgagcacgggcaccgtggtg
aagcgtccggtggtggtcgaggagccgcagctgggcgaggtgatcacggtccggtccatg
gtgtacctgtcgttgagcttcgaccaccggctcatcgacggcgcggatgcggcccggttc
ctctccgatgtgaagcgccggttggaggagggcgcgttcgaggacgctgtggggctcaag
tag

DBGET integrated database retrieval system