KEGG   Thermobifida fusca: Tfu_0994Help
Entry
Tfu_0994          CDS       T00265                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
tfu  Thermobifida fusca
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_0994
   00020 Citrate cycle (TCA cycle)
    Tfu_0994
   00620 Pyruvate metabolism
    Tfu_0994
   00630 Glyoxylate and dicarboxylate metabolism
    Tfu_0994
   00640 Propanoate metabolism
    Tfu_0994
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_0994
   00280 Valine, leucine and isoleucine degradation
    Tfu_0994
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Tfu_0994
Exosome [BR:tfu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Tfu_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1166577..1167956)
Genome map
AA seq 459 aa AA seqDB search
MSESGGTFDLVILGGGSGGYSAAIRASELGMRVALIEKDKLGGTCLHYGCIPTKALLHAG
EVADTVRASEKFGVRASFDTIDMARVHEYKDKVVSGLHRGLTGLIKARGITLVEGEGKLT
GVDEVTVNGVAYKGRHIILATGSQARSLPGLEIDGERIITSYEALRLDRVPKSAIILGGG
VIGVEFASVWRSFGAEVTIVEALPHLVPAEEESSSKLLERAFRKRGIKFELGSPFESVKL
TETGVSMTLASGKTVEGELLLVAVGRGPVSQGLGYEEVGIRLERGFVQVDENLHTGVGNI
YAVGDLIPTPQLAHVGFAEGIFVAEHIAGLNPVNIDYDGIPRVTYSDPEVASVGITSKTA
AERGIETTEFVYNLAGNGKSQILQTQGAVKVIAAKDGPVLGVHMVGSRVGELITEGQLIY
NWEALPSEVAQLIHAHPTQSEALGEAHLALAGKPLHVHD
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaagcggcggcacattcgatctcgtcatcctgggcggcggtagcggtggctac
tcggccgccatccgcgcctccgaactcggcatgcgtgtcgccctgattgagaaagacaag
ctcggcggcacctgcctgcactacggctgtattccgaccaaggccctgctgcacgcgggt
gaggtcgccgacacggtgcgggccagcgagaagttcggtgtccgggcctcgttcgacaca
atcgacatggcccgtgtccacgagtacaaggacaaggtcgtcagtggtctgcaccgcggc
ctgaccggtctgatcaaggcccgcggcatcaccctggtcgagggtgagggcaagctgacc
ggtgtcgacgaggtcacggtcaacggggtggcctacaagggtcggcacatcatcctggcc
accgggtcccaggcgcgttcgctccctggtctggagatcgacggggagcggatcatcacc
agctacgaggcgctccgcttggaccgggtccccaagtccgcgatcatcctgggcggcggt
gtcatcggcgtcgagttcgccagcgtgtggcgttcgttcggcgccgaggtgacgattgtc
gaggcgctgccgcacctggtcccggcggaggaggagtccagctccaagctgctggagcgg
gcgttccgcaagcgcgggatcaagttcgagctgggcagcccgtttgagagcgtgaagctc
accgagaccggggtgagcatgacgctggcgagcggcaagaccgtggaaggcgagctgctg
ctggtggcggtgggccgcggtccggtctcccaggggctgggctacgaggaggtcggcatc
cgcctggagcgcggcttcgtccaggtcgatgagaacctgcacaccggagtcggcaacatc
tacgcggtgggcgacttgatccccacgccgcagttggcgcacgtcggctttgccgagggt
attttcgtcgccgagcacattgccgggctgaacccggtgaacatcgactacgacggtatt
ccgcgggtcacctactccgacccggaggtggcgtccgtggggatcacctccaagaccgcg
gccgaacgcgggatcgagaccaccgagttcgtctacaacttggcgggcaacgggaagagc
cagatcctgcagacccagggcgcggtcaaggtcatcgcggccaaggacggcccggtgctg
ggtgtgcacatggtgggcagccgcgtcggcgagctgatcaccgagggccagctgatctac
aactgggaggcgctgccgtctgaggtggcgcagctcatccacgcgcatccgacccagtcc
gaggcgttgggcgaggcccacttggcgctagcgggcaagccgttgcacgtccacgactga

DBGET integrated database retrieval system