KEGG   Thermobifida fusca: Tfu_0997Help
Entry
Tfu_0997          CDS       T00265                                 

Definition
(GenBank) adenosylcobinamide kinase
  KO
K02231  
adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC:2.7.1.156 2.7.7.62]
Organism
tfu  Thermobifida fusca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tfu_0997
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.156  adenosylcobinamide kinase
     Tfu_0997
   2.7.7  Nucleotidyltransferases
    2.7.7.62  adenosylcobinamide-phosphate guanylyltransferase
     Tfu_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1170501..1171469)
Genome map
AA seq 322 aa AA seqDB search
MDDVLSLSSPDGLVSNLLPAGYSAAQTPYGLRVDGADGGRLLFARPDAPATPPPDSDPED
PRPDHQADLVLVDVGESPETIGALRRAGVVGLTTVVVAVGGDHRVHSPAEFDRRARLWGA
LAPLDGQELRCPPDAWPPSRPHGPYRVLVTGGARSGKSSEAELRLLGEPEVLYVATGPAP
DPHADAAWAQRVAAHRSRRPAWWRTVETTDVAAVLAKADGAVLFDCVGTWLAHVMGECGM
WADEVPADAEQRLEERIDALVAAWRTSAAYVVAVTNEVGSGVVPPTVSGGLFRDWLGRVN
QRLAAESEEVVLVTAGRVLSLS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggacgatgtcttgagcctgtcctcccccgatgggctggtgtcgaacctgcttccggcc
ggctattcggcggcgcagacgccttacgggctgcgggtggacggcgcggacggcggccgg
ctgctgtttgcgcggcctgacgctccggcgactcccccgccggacagcgatccggaggat
ccgcgtcccgaccaccaggcagacctggtgctggtggatgtgggcgagtcgccggagacg
atcggtgcgctgcggcgggcaggcgtggtggggctgaccacggtcgtggtggcggtgggc
ggcgaccaccgggtgcattctccggccgagttcgaccgccgggcccggctgtggggggcg
ttggccccgttggacggccaggagctgcggtgcccgccggatgcgtggccgccgtcgcgg
ccgcacggcccgtaccgggtgctggtgacgggcggggcgcggtctgggaagtcgtcggag
gcggagctgcggctgctgggggagccggaggtgctctacgtggcgacgggcccggccccg
gatccgcacgcggatgcggcgtgggcgcagcgggtggccgcacaccggtcgcgccgcccg
gcgtggtggcgcacggtggagacgacggatgtcgcggcggtgctggcgaaggcggacggc
gcggtgctgttcgactgtgtgggcacgtggctggcgcacgtcatgggcgagtgcgggatg
tgggcggacgaggtgcctgcggacgcggagcagcggctggaggagcggatcgacgcgctg
gtggcggcgtggcggacgagcgcggcctacgtggtggcggtgacgaacgaagtggggtcg
ggtgtggtaccgccgacggtgagcggggggctgttccgggactggctgggccgggtgaac
cagaggctggccgccgagtcggaggaggtcgtgctggtcacggccgggcgggtgctgtcg
ctgtcgtga

DBGET integrated database retrieval system