KEGG   Thermobifida fusca: Tfu_0998Help
Entry
Tfu_0998          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1171692..1171898
Genome map
AA seq 68 aa AA seqDB search
MAWSWRYEKADGTVLSGEDLPDTLFPSRGDAESWLGEHWRTLRESGAERVVLLNEGVAKY
TMSLNDEI
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggagctggcggtacgagaaagccgatgggaccgtgctcagcggtgaagacctc
cccgacaccctgttcccctcccgcggcgacgcggaaagctggctcggagaacactggcgg
accctgcgcgaatccggagcagaacgggtcgtcctgctcaacgaaggcgtcgccaaatac
acgatgagtctgaacgacgagatctag

DBGET integrated database retrieval system