KEGG   Thermobifida fusca: Tfu_1000Help
Entry
Tfu_1000          CDS       T00265                                 

Definition
(GenBank) probable phosphoesterase YhaO-putative DNA repair exonuclease
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1175505..1176755)
Genome map
AA seq 416 aa AA seqDB search
MKLLHAADLHIDSPLRGLSRYEGAPADQLRGATRQALENLVTLALEEEVTAVLLAGDIYD
GDWPDYNTGLFFTRQMTRLCDAGIPVYLIAGNHDAANLMTRTLTASLPKNVHYFPTERPA
TVVDEQRGLAVHGQGFAQREVRANLAEHYPAPRSGLFNVGLLHTALTGREGHEPYAPCRI
DQLVDHGYEYWALGHVHQRQVEYDADVKVVFPGNIQGRNVREAGPKGCTLVTVDDRHRVT
GLRHHDLDTAARWHELRVDVRSARDVSDVLTLVSEQLDKELAGDTEPNRVHAVRVVVEGP
TDAHEQLHRDHEKLLNELRAIAAQRPDTWLEKLRVKTSPPEERLDAAHADELVGELWRTA
ARLSASPEQLTEVIASAELLGKLPLQLREELSDPQRQRDLLAEAVELLAAELGGAQ
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgctccacgccgctgatctgcacatcgacagtccactgcggggcctttcccgg
tacgagggggccccggccgaccagttgcgcggggcgacacggcaggctttggagaacctg
gtgactctcgccttagaggaggaggtcaccgcggtgctgctcgccggggacatctacgac
ggggactggcccgactacaacaccgggctgttcttcacccggcagatgacccggctgtgc
gacgccggcatcccggtgtatttgatcgcgggcaaccacgacgcggcgaacctgatgacg
cggacgctgaccgcttccctgccgaagaatgtgcactactttcccacggagcgccccgcc
acggtggtcgacgagcagcgcgggctcgccgtccacggccaggggttcgcccagcgggag
gtcagggcgaacctggccgaacactatcccgcgccgcggtccggcttgttcaacgtcggc
ctgctgcacactgcgctcaccggtcgagaaggacacgagccgtacgccccgtgccgtatc
gaccagttggtcgaccacggctacgagtactgggcgctgggccacgtccaccagcggcag
gtggaatacgacgccgacgtcaaagtggtgttcccggggaacattcaggggcggaacgtc
cgcgaggccgggcctaaaggctgcacgctggtcaccgtggacgaccgccaccgggtgaca
gggctgcgccaccacgacctcgacacggcggctcgctggcacgagctgcgggtggatgtg
cgcagcgcccgcgatgtatccgacgtgctcaccctggtctccgagcagctcgacaaggag
ctggccggggacaccgaacccaaccgcgtccacgcggtgcgggtggtggtcgaaggcccc
acggacgcccacgagcagttgcaccgcgaccacgagaagctgttgaacgagctgcgcgct
atcgccgcgcagcgcccggacacctggttggagaagctccgggtgaagacgtctccccct
gaggagcgtctcgacgccgcccacgcggacgagctggtcggtgagctgtggcggaccgcg
gcccggctctccgcatccccggagcagctcaccgaggtcatcgcgtcggccgaactgctg
ggcaaactgcctcttcagctgcgggaagagctgagcgacccgcagcggcagcgcgacctg
ttggcggaggcggtggagctgctggccgctgagctggggggtgcgcagtga

DBGET integrated database retrieval system