KEGG   Thermobifida fusca: Tfu_1010Help
Entry
Tfu_1010          CDS       T00265                                 

Definition
(GenBank) glycerate kinase
  KO
K00865  
glycerate 2-kinase [EC:2.7.1.165]
Organism
tfu  Thermobifida fusca
Pathway
Glycine, serine and threonine metabolism
Glycerolipid metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tfu_1010
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tfu_1010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_1010
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     Tfu_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1184840..1185931
Genome map
AA seq 363 aa AA seqDB search
MIAPDKFAGTLTAVEAAEAIADGWRSVDPDTHCTLVPLSDGGPGFVDVLHTALGGTLVAT
EATGPLGTPVQARFLLVGQTAYVESAQACGLHLLPAKDRNPETTTTYGVGELIGAAIDRG
ATTVVVGLGGSGTNDGGAGMLAALGATPAEPLRSGGGALTGLDRVDLAAARARVAGIRLI
AATDVDNPLLGAHGASAVFGPQKGADAAQVQRLDAALAHFADLTDPETTLRATPGAGAAG
GLGYGLLLLGGTVESGVRRVLGAVGLDTLVASADAVITGEGSFDSQSLRGKLPHGVAQTA
SRHGVPCVVLAGRVAVAEEEAAAAGVTAAHSLVESAGSVQAALEHSARELRRLAARVAAD
WPR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctcctgacaagttcgctggaaccctcaccgcggtcgaagcagccgaagccatc
gcagacggctggcgctccgtcgacccggacacccactgcaccctggtgccgctctccgac
ggcggccccggattcgtcgacgtgctgcacacggcgctcggcggcaccctcgtcgccacc
gaagccaccgggccgctcggcaccccggtgcaggcccgcttcctcctcgtcggacagacc
gcctacgtggaaagcgcccaagcgtgcggcctccacctgctgcccgctaaagaccgcaac
ccggaaaccaccaccacctacggggtaggggagctgatcggcgcagccatcgaccgcggc
gccaccaccgtcgtcgtcggcctgggcggcagcggcaccaacgacgggggagcgggcatg
ctcgccgccctcggcgctacgcccgccgaaccactgcggagcggcggcggtgccctcacc
ggcctagaccgcgtcgacctggccgcggcccgcgcccgcgtcgccggcatccggctcatt
gccgccaccgacgtggacaacccgctgctcggcgcccacggcgccagcgccgtcttcgga
ccgcagaaaggcgcggacgccgcccaagtccagcgcctggacgccgcgctcgcccacttc
gcggacctcaccgacccggagacgacgctgcgcgccacgcccggagccggggcagccggc
gggctcggctacggactgctgctgctcggcggcaccgtcgaatccggggtgcgcagagtg
ctgggcgcggtcggcctcgacaccctcgtggcctccgccgacgcggtcatcaccggggaa
gggtccttcgactcccagtccctgcgcggcaaactcccgcatggggtagcgcagaccgcg
tcccggcacggcgtgccctgcgtcgtcctcgccggccgggtcgccgtcgcggaagaagaa
gccgccgcggcaggcgtcaccgcagcccactccctcgtcgaatccgcgggatcagtgcag
gccgccctggagcactccgcgcgggaactgcgccgcctcgcagcccgcgtcgcagcggac
tggccgcgctga

DBGET integrated database retrieval system