KEGG   Thermobifida fusca: Tfu_1016Help
Entry
Tfu_1016          CDS       T00265                                 

Definition
(GenBank) cytochrome-c oxidase
  KO
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
tfu  Thermobifida fusca
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Tfu_1016
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Tfu_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1190145..1191836
Genome map
AA seq 563 aa AA seqDB search
MTTTVETPTATVRASATARRATPGSKIVSWLTTTDHKVIGYMYLITSFAFFLLAGVMALL
IRAELMYPGMQLMNNETYNQLFTMHGTIMLFLFATPLFVGFGNVLLPLQIGSPDVAFPRL
NLFGYYLFLFGGLIVVAGFITPGGAASFGWFSYVPLSDAVRSPGLGGDLWIMGLAISGLS
TILGSVNFITTVVCMRAPGMTMFRMPIFTWNVVLTSVLVLLAFPVLTGAFAGLAADRIIG
AQIFNPEHGGPILYQHLFWFFGHPEVYIIALPFFGIVTEILPVFSRKPIFGYKSLIGATI
AIAGLSITVWAHHMFPTGAVLLPFFSFMTFLIAVPTGVKFFNWIGTMWRGQLTFETPMLF
SIGFMTTFLFGGLTGVILASPPLDFHVTDSYFVVAHFHYTVFGTVVFAMFAGFYFWWPKF
TGKMLNEKLGKLHFWTLFFGFHGTFLIQHWLGAEGMPRRYADYLPADGFTLLNQISTVSS
FVLGASTLFFLWNVWTTAKNAPKVTVDDPWGYGCSLEWATSCPPPRHNFVSLPRIRSERP
AFDLHHPYAATPAVAEPATASTK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacggttgagactccgacggcgaccgtccgggcatccgccacagctcggcgg
gccaccccgggctcgaaaatcgtcagctggctgacgacaaccgatcacaaggtgatcggg
tacatgtacctgatcacctcgttcgcattcttcctgctcgccggtgtcatggcgctgctg
atccgggccgagttgatgtacccgggcatgcagctgatgaacaacgagacctacaaccag
ttgttcaccatgcacggcacgatcatgctgttcctgttcgcgacgccgctgttcgtcggg
ttcgggaacgtgctgctgccgctgcagatcgggtcacccgacgtggcctttccccggctc
aacctgttcgggtactacctgttcctgttcggcggcctgatcgtggtagccgggttcatc
acgcccggcggtgcggcgagcttcggctggttctcctacgtgccgctctcggatgcggtc
cgttccccggggctcggtggcgacctgtggatcatgggtctggccatcagcggtctgagc
accatcctcggctcggtgaacttcatcaccacggtcgtgtgcatgcgcgcccccggtatg
accatgttccgcatgccgatcttcacgtggaacgtggtgctcaccagcgtgctcgtgctg
ctggccttcccggtgctcaccggtgccttcgccgggctggcggctgaccgcatcatcggt
gcgcagatcttcaaccccgagcacggcgggccgatcctctaccagcacctgttctggttc
ttcggccacccggaggtctacatcatcgcgctgccgttcttcggcatcgtcaccgagatc
ctcccggtgttcagccgcaagccgatcttcggctacaagagcctgatcggcgccaccatc
gcgatcgcgggactctccatcacggtgtgggcgcaccacatgttccccaccggcgcggtg
ctgctgccgttcttctccttcatgaccttcctcatcgcggtgccgaccggcgtgaagttc
ttcaactggatcggcaccatgtggcgcggccagctcaccttcgagacgccgatgctgttc
tccatcggcttcatgaccaccttcctgttcggtggcctcaccggtgtgatcctggcctcc
ccgccgctggacttccacgtcaccgactcgtacttcgtggtggcccacttccactacacg
gtgttcggcaccgtggtgttcgcgatgttcgcgggcttctacttctggtggccgaagttc
accggcaagatgctcaacgagaagctgggcaagctccacttctggacgctgttcttcggc
ttccacggcaccttcctcatccagcactggctgggcgcggaaggcatgccgcgccgctac
gcggactacctgccggcggacggcttcacgctgctcaaccagatctccacggtctcgtcc
ttcgtcctcggtgcgtccaccctgttcttcctgtggaacgtctggacgaccgcgaagaac
gctccgaaggtgaccgtggacgacccgtggggctacggctgctcgctggagtgggcgacc
tcctgcccgccgccgcggcacaacttcgtctcgctgccgcggatccgctctgagcggccc
gccttcgacctgcaccacccgtacgcggcgacccccgcggtcgctgagccggccacggcg
agcacgaagtag

DBGET integrated database retrieval system