KEGG   Thermobifida fusca: Tfu_1031Help
Entry
Tfu_1031          CDS       T00265                                 

Definition
(GenBank) long-chain fatty-acid-CoA ligase
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
tfu  Thermobifida fusca
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Quorum sensing
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Tfu_1031
   00071 Fatty acid degradation
    Tfu_1031
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Tfu_1031
Enzymes [BR:tfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Tfu_1031
Lipid biosynthesis proteins [BR:tfu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Tfu_1031
Exosome [BR:tfu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Tfu_1031
  Exosomal proteins of breast cancer cells
   Tfu_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1208065..1209861)
Genome map
AA seq 598 aa AA seqDB search
MREYTTPAVKELDPDTRLTDTVFTRAAQEPNAVMFRRLVDGAWRDVTCAEFHRDVMGVAK
ALIAAGINHGDRVALMSRTRYEWTVIDYAIWTIGGVTVPIFDTSSEEQVEWILRDSGSTL
AFVENDEHAERVRAVSAQLLEPDRIVQIESDSFPAFVATGADVADSVVEERRAATGLDDL
ATLIYTSGTTGRPKGCELTQRNLAFDVMSVNSGPMKDVFTMEGRSTLLFLPLAHSLARII
QVGCVETKTVMGHFPSTGPDLLDALASFRPMFLLAVPRVFEKVYNKAEQKAIASGKGDIF
RKAAETAIAYSKALDTGKVSLGLRLKRAVFSLLVYRKILAAVGGQAKYAVSGGSALGERL
GHFFRGIGLTVLEGYGLTETSAPTTANAPDTNKIGTVGRPIPGTSIRIADDGEILVKGDN
VMRGYWNNPKATKEAFTEDGWYRSGDIGELDEEGFLRITGRKKEIIVTAGGKNVAPAVIE
DRIRSHAIVSQCMVVGDNRKFVAALITIDPEAFEFWKKQHNKTGTIAELVDDPDLRATVQ
KAVDDGNKAVSRAESVRKFAILPVDFSEAEGHMTASLKLKRHVIEKQFSAEIEALYAE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagtacaccacccccgcggtaaaggaacttgacccggatacacgactcactgac
accgtcttcacccgtgcggctcaggaacccaacgccgtgatgttccggcggctcgtggac
ggtgcgtggcgagacgtgacctgcgctgaattccaccgcgacgtcatgggcgtggccaag
gcgctcatcgccgccgggatcaaccacggcgaccgggtagcgctcatgtcgcggacccgc
tacgagtggaccgtcatcgactacgccatctggaccatcggcggagtgaccgtccccatc
ttcgacacctcctccgaagagcaggtcgagtggatcctccgcgactcgggaagcacgctc
gccttcgtggagaacgacgagcacgcggaacgagtccgggctgtctccgcacaactcctg
gaacccgaccgcatcgtgcagatcgaaagcgacagcttccccgctttcgtcgccaccggc
gcggacgtggctgactcggtggtggaggagcgccgcgccgccaccggcctcgacgacctc
gccaccctgatctacacctcgggcaccaccggccgtcccaaaggctgcgagctcacccag
cgcaacctggccttcgacgtcatgagcgtcaacagcggccccatgaaggacgtcttcacc
atggaggggcgctccaccctcctgttcctcccgctggcgcactcgctggcccgcatcatc
caggtcggctgcgtggagacgaagaccgtcatgggccacttcccctccaccggcccggac
ctgctggacgcgctcgcttcgttccgccccatgttcctgcttgccgtgccccgcgtgttc
gagaaggtctacaacaaggctgagcagaaggccatcgccagtggcaagggcgacatcttc
cggaaggccgcggagaccgccatcgcctacagcaaggcgctggacaccgggaaggtgagc
ctggggctgcgtctcaagcgcgccgtgttcagcctgctcgtctaccgcaagatcctggct
gcggtgggcgggcaggccaagtacgccgtctccggtggttccgccctgggtgagcggctc
ggccacttcttccgcgggatcggcctgaccgtcctggaaggctacggtctgaccgagacg
tccgcccccaccaccgcgaatgcccccgacaccaacaagatcggcacggtgggccgcccc
atccccggcacgtcgatccggatcgccgacgacggggagatcctcgtcaagggcgacaac
gtgatgcgcggctactggaacaacccgaaggcgacgaaggaggcgttcaccgaggacggc
tggtaccgcagcggcgacatcggcgaactcgacgaggaaggcttcctgcggatcaccggg
cggaagaaggagatcatcgtcaccgcaggcgggaagaacgtcgcccccgcggtcatcgag
gaccggatccgcagccacgcgatcgtcagccagtgcatggtcgtcggcgacaaccgcaag
ttcgtcgccgcgctcatcaccatcgacccggaagccttcgagttctggaagaagcagcac
aacaagaccggcaccatcgccgagctggtggacgaccccgacctgcgggccaccgtgcag
aaggcggtggacgacggcaacaaggcggtctcccgggccgagtcggtacggaagttcgcc
atcctgccggtggacttcagcgaggctgaaggccacatgaccgcgtcgctgaaactcaag
cggcacgtcatcgaaaagcagttcagcgcggagatcgaggcgctctacgccgagtga

DBGET integrated database retrieval system