KEGG   Thermobifida fusca: Tfu_1032Help
Entry
Tfu_1032          CDS       T00265                                 

Definition
(GenBank) hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1210088..1210561
Genome map
AA seq 157 aa AA seqDB search
MELGSTVRGWQSGADSTAADGYGEKRQPSDRRMTMASSHRNQDPSEIIDEALRLVDAVQR
RLLTAAIRRQVQNAASPPPRSDDVWAEAIRQETEPEAPLTDQVLDIARETLPEIGRHLSA
AGALMFDAMSRSLSAVERSLRSRPGNGAAGTPADGEQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtggaactcggatcaacagtgcgcggttggcaatctggcgcagacagtaccgcagcagac
ggttacggtgagaagaggcaaccgagcgacagacggatgaccatggccagttcccaccgc
aaccaggatccgagcgagatcatcgacgaagcgctgcgcctcgtggacgccgtgcagcgc
aggctgctcaccgccgccatccggcggcaagtccagaacgccgcctctccgccgccgcgc
agcgatgatgtatgggcagaggcgatccggcaggagacagagccggaggccccgctgacc
gaccaggtgctcgacatcgcgcgcgaaaccctgcccgaaatcggccgccacctgagcgcc
gcgggcgcgctgatgttcgacgctatgagtcgtagtctgtccgcggtggagcgttcgctg
cggtcccgtcccgggaacggcgccgccggaactcccgctgacggggaacaatag

DBGET integrated database retrieval system