KEGG   Thermobifida fusca: Tfu_1033Help
Entry
Tfu_1033          CDS       T00265                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tfu  Thermobifida fusca
Pathway
tfu00010  Glycolysis / Gluconeogenesis
tfu00052  Galactose metabolism
tfu00500  Starch and sucrose metabolism
tfu00520  Amino sugar and nucleotide sugar metabolism
tfu00521  Streptomycin biosynthesis
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_1033
   00052 Galactose metabolism
    Tfu_1033
   00500 Starch and sucrose metabolism
    Tfu_1033
   00520 Amino sugar and nucleotide sugar metabolism
    Tfu_1033
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tfu_1033
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tfu_1033
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tfu_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AAZ55071
JGI: Tfu1033
UniProt: Q47R46
Position
1210691..1211638
Genome map
AA seq 315 aa AA seqDB search
MRLTIGVDIGGTKVAAGVVDVDGRILTRVKHPTPADGDALADVVCDTVDELAGHYPAGAI
GGVGVGIAGFVDENRSTVIFAPNLDLCKEPLRDRIRRRIDLPVIIENDANAAAWGEARFG
AGRGVDHVVCVTLGTGIGGGIILNGQLFRGRYGVGAEIGHYRVVPDGRLCGCGNRGCWEK
YASGRALVAEARELARTDPRRAKRLLDFADGDPERLQGHHITQAALEGDAAALECFTTLG
TWVGQGLADLAAILDPERFVIGGGVCEAGEILLGPIRDSFARNVTGRQVRTLADIRIAEL
GSAAGIVGAADLVRC
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgacgatcggcgtggacatcggtggcaccaaggtggccgccggcgttgtcgat
gttgacggccggatcctgacgagggtcaagcaccccactcccgccgacggcgacgccctc
gccgatgtggtctgcgacaccgttgacgaactcgcgggacattaccccgccggcgccatc
ggcggagtcggcgtgggtatcgccgggttcgtcgacgagaatcgttccaccgtcatcttt
gcccccaacctggacctgtgcaaagaaccactgcgcgaccgcatccggcgccggatcgac
cttcccgtcatcatcgagaacgacgccaatgcggcggcgtggggcgaagcacggttcggc
gcaggccgcggcgtcgaccatgtggtgtgcgtcaccctaggcaccgggatcgggggcggc
atcatcctcaacgggcaactgttcagaggccgctacggggtgggcgcggaaatcggccac
taccgcgtagtcccggacgggcgcctgtgcggctgcggcaaccggggctgctgggagaag
tacgccagcggacgcgccctcgtcgctgaagcgcgcgagctggcccgcaccgacccccgg
cgcgccaagcggctcctcgacttcgcggacggcgacccggaacgcctccaagggcaccac
atcacccaggccgccctcgaaggcgacgctgccgcgctggaatgcttcaccaccctcggc
acctgggtggggcaagggctagccgacctcgccgcgatcctcgacccggaacggttcgtc
atcggcggcggggtctgcgaagccggagaaatcctgctcggcccgatccgcgactctttc
gcgcgcaacgtcaccggccgccaggtgcggaccctcgccgacatccggatcgcggaactc
gggtcggcggcgggcatcgtgggtgcggccgacctcgtgcgctgctaa

DBGET integrated database retrieval system