KEGG   Thermobifida fusca: Tfu_1033Help
Entry
Tfu_1033          CDS       T00265                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tfu  Thermobifida fusca
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tfu_1033
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_1033
   00052 Galactose metabolism
    Tfu_1033
   00500 Starch and sucrose metabolism
    Tfu_1033
   00520 Amino sugar and nucleotide sugar metabolism
    Tfu_1033
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tfu_1033
   00524 Butirosin and neomycin biosynthesis
    Tfu_1033
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tfu_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1210691..1211638
Genome map
AA seq 315 aa AA seqDB search
MRLTIGVDIGGTKVAAGVVDVDGRILTRVKHPTPADGDALADVVCDTVDELAGHYPAGAI
GGVGVGIAGFVDENRSTVIFAPNLDLCKEPLRDRIRRRIDLPVIIENDANAAAWGEARFG
AGRGVDHVVCVTLGTGIGGGIILNGQLFRGRYGVGAEIGHYRVVPDGRLCGCGNRGCWEK
YASGRALVAEARELARTDPRRAKRLLDFADGDPERLQGHHITQAALEGDAAALECFTTLG
TWVGQGLADLAAILDPERFVIGGGVCEAGEILLGPIRDSFARNVTGRQVRTLADIRIAEL
GSAAGIVGAADLVRC
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgacgatcggcgtggacatcggtggcaccaaggtggccgccggcgttgtcgat
gttgacggccggatcctgacgagggtcaagcaccccactcccgccgacggcgacgccctc
gccgatgtggtctgcgacaccgttgacgaactcgcgggacattaccccgccggcgccatc
ggcggagtcggcgtgggtatcgccgggttcgtcgacgagaatcgttccaccgtcatcttt
gcccccaacctggacctgtgcaaagaaccactgcgcgaccgcatccggcgccggatcgac
cttcccgtcatcatcgagaacgacgccaatgcggcggcgtggggcgaagcacggttcggc
gcaggccgcggcgtcgaccatgtggtgtgcgtcaccctaggcaccgggatcgggggcggc
atcatcctcaacgggcaactgttcagaggccgctacggggtgggcgcggaaatcggccac
taccgcgtagtcccggacgggcgcctgtgcggctgcggcaaccggggctgctgggagaag
tacgccagcggacgcgccctcgtcgctgaagcgcgcgagctggcccgcaccgacccccgg
cgcgccaagcggctcctcgacttcgcggacggcgacccggaacgcctccaagggcaccac
atcacccaggccgccctcgaaggcgacgctgccgcgctggaatgcttcaccaccctcggc
acctgggtggggcaagggctagccgacctcgccgcgatcctcgacccggaacggttcgtc
atcggcggcggggtctgcgaagccggagaaatcctgctcggcccgatccgcgactctttc
gcgcgcaacgtcaccggccgccaggtgcggaccctcgccgacatccggatcgcggaactc
gggtcggcggcgggcatcgtgggtgcggccgacctcgtgcgctgctaa

DBGET integrated database retrieval system