KEGG   Thermobifida fusca: Tfu_1035Help
Entry
Tfu_1035          CDS       T00265                                 

Definition
(GenBank) hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1212434..1213270)
Genome map
AA seq 278 aa AA seqDB search
MPRFLPADAARGPPSTAGALLCAPPDAGKGPDMTERRGNGLLADSYVPLLLLTPALADTM
LEALGRAGIAAYAVTVGPAAESADTEATDRLYVDAKERAAAVAVLRAELPELADRVTEGA
DQAEDAEPSPNADTDPDEVWADLVARYYTSDASESTWPEIENVSDRPEPEDPDDAEDHVL
PPRPFHPPVGEPADVDDSDQERYVPPPPPPLPRGDLVGRLAWAGLLGGPVLLLVITLLGM
AVPGWLVLVALCSFVTGFVVLLIRMGDQPSGPDDGAVV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggttccttcctgcggacgcggcacggggaccgccgtcgacggctggggcgctt
ctgtgcgcgccgccggacgcggggaaggggccggacatgactgagcgccgcggcaatggt
ctgcttgctgactcctacgtcccgctgctcctgctcacccccgcgctcgccgacacgatg
ctcgaagcgctcggccgggccgggatcgccgcctacgcggtcaccgtgggccccgcggcg
gagtccgcggacacggaggccacggaccgcttgtacgtggacgctaaggagcgcgcggcc
gcggtggcggtgctgcgcgccgaacttccggagctcgccgaccgtgtcacggagggtgcg
gaccaggcggaggacgcggagccgtccccgaacgccgacacagacccggacgaggtctgg
gcggatctcgtggcgcggtactacacctccgatgcttccgagtccacctggcctgagata
gagaacgtctccgaccgccccgaaccggaggatccggacgacgccgaggaccacgtgctg
ccgcctcggccgttccaccccccggtgggggagcccgccgacgtcgacgacagcgaccag
gagcgttacgtccctcctcccccgccgccgctgccccgtggggacctggtcggcaggctc
gcctgggccggtctgctgggcgggcccgtcctgctgctggtcatcaccctgctgggcatg
gcggtgcccggctggctggtgctggtggcgctgtgctcgttcgtgacggggtttgtcgtg
ctgctgatccgcatgggcgaccagccctccggtccggacgacggggcggtggtctag

DBGET integrated database retrieval system