KEGG   Thermobifida fusca: Tfu_1037Help
Entry
Tfu_1037          CDS       T00265                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tfu  Thermobifida fusca
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tfu_1037
   01230 Biosynthesis of amino acids
    Tfu_1037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_1037
   00030 Pentose phosphate pathway
    Tfu_1037
   00051 Fructose and mannose metabolism
    Tfu_1037
   00052 Galactose metabolism
    Tfu_1037
  Energy metabolism
   00680 Methane metabolism
    Tfu_1037
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tfu_1037
Protein phosphatases and associated proteins [BR:tfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tfu_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1214880..1215905
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIKEYGYEFVGFRDGWRGPLEGDTMPLDIEAVRGI
LPRGGTILGSSRTNLMKIEGGVERVKDNMAALGVDALVAIGGEDTLGVARQLHDHGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIATEAIDRLHTTAESHHRALVVEVMGRHAGWIALHA
GMAAGANVILIPERPFDIDEVVAYIESRFKTNYAPIIVVAEGAHPKEGQLTLASAERDSF
GHVRLGGIGQRLAEEIEARTGKEARSVVLGHVQRGGTPSAFDRVLATRLGLHAITAVHDK
DFGKMVALRGTEIVRVDLSEATDQLKTVPVERYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggggtactgaccgggggtggcgactgcccgggcctgaacgcggtcatccgt
gcggtggtccgtaagggcatcaaggaatacggatacgagttcgtcggattccgtgacggg
tggcgcggccccctggaaggcgacaccatgccgctggacatcgaggcggtccgcggcatc
ctcccgcgcggcggtaccatcctcggctcctcgcgcaccaacctcatgaagatcgagggc
ggtgtcgagcgggtcaaggacaacatggccgcgctcggggtggacgcgctcgtcgcaatc
ggcggtgaggacaccctcggcgtcgcgcgccagctccacgaccacggtgtcaacgtggtc
ggtgtgcccaagaccatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
actgcggtcaacatcgcgaccgaggccatcgaccgcctgcacaccaccgccgagtcgcac
caccgtgccctggtcgtcgaggtcatgggccgccacgcgggctggattgcgctgcacgcg
ggcatggcggccggcgccaacgtcatcctgatccccgagcgcccattcgacatcgacgag
gtcgtcgcctacatcgaaagccgcttcaagaccaactacgcgccgatcatcgtggtcgcc
gagggcgcccacccgaaggagggccagctcaccctggccagcgcggaacgcgactccttc
ggccacgtccgcctcggcggcatcggccagcgcctcgccgaagagatcgaggcgcgcacc
ggcaaggaagcccgctcggtggtcctgggccacgtgcagcgcggcggtacgccgtccgcc
ttcgaccgggtgctggccacccggctgggcctgcacgccatcaccgcggtccacgacaag
gacttcggcaagatggtcgccctgcgcggcaccgaaatcgtccgcgttgacctgtccgaa
gccaccgaccagctcaagactgtcccggtcgagcggtacgaggaagccgaagtcttcttc
ggctaa

DBGET integrated database retrieval system