KEGG   Thermobifida fusca: Tfu_1046Help
Entry
Tfu_1046          CDS       T00265                                 

Definition
(GenBank) thiamine monophosphate synthase
  KO
K00788  
thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
tfu  Thermobifida fusca
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Tfu_1046
Enzymes [BR:tfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     Tfu_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1224203..1224859
Genome map
AA seq 218 aa AA seqDB search
MDETLRKRLESARLYLCTDARADRGDLAEFLDAALAGGVDIVQLRDKTLDARDELAALEV
VREACDRHGALLAVNDRADIAHAVNADVLHLGQRDLPVRYARAILGDRPLIGRSTNAAEL
SAAADREEGVDYFCIGPVWATPTKPGRPAAGLDEVARVAALHPQRPWFAIGGINEDNLDQ
VLAAGARRAVVVRAITEAEDPRAAAAELKRRLVAAAAA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtggacgagactctgcgaaagcggttggaatccgcccggctctacctgtgcacggacgcc
cgcgccgaccgaggcgacctggccgagttccttgatgcggcgctcgccgggggcgtggac
atcgtgcaactgcgcgacaagaccctggacgcgcgggacgagctcgccgcgctggaagtc
gtgcgtgaggcgtgcgaccgccacggggcgctgctcgcggtcaacgaccgggccgacata
gcccacgccgtcaacgccgacgtgctgcacctgggacagcgggacctgcccgtgcgctac
gcccgcgcgatcctcggggaccggccgctgatcggccgctccaccaacgcggcggagctg
tctgcggccgccgaccgggaagaaggcgtcgactacttctgtatcggcccggtgtgggcg
accccgaccaaaccgggacggcccgctgccgggctcgacgaggtggcgcgggtcgccgcc
ctgcacccgcagcgcccctggttcgcgatcggcgggatcaacgaggacaacctggaccag
gtgctggccgcgggcgcccgccgggctgtcgtggtccgcgccatcaccgaagccgaagac
ccgcgtgcggcggcggcggagctcaaacgccgcctcgtggcagcggccgcagcctga

DBGET integrated database retrieval system