KEGG   Thermobifida fusca: Tfu_1053Help
Entry
Tfu_1053          CDS       T00265                                 

Definition
(GenBank) uracil phosphoribosyltransferase
  KO
K02825  
pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
tfu  Thermobifida fusca
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tfu_1053
Enzymes [BR:tfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     Tfu_1053
Transcription factors [BR:tfu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Tfu_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1230573..1231196
Genome map
AA seq 207 aa AA seqDB search
MHAHNHAGGERPDQRRAVLEGPEISRALTRIAHEILERTKGGHDLTLLGIRTGGVPLAQR
LAERIERVEQRPVPWGALDITMYRDDLRLAPARALGSTDIPPEGVDGRTVVLVDDVLFSG
RTVRAALDALNDLGRPRAVQLAVLVDRGHRELPIRADYVGKNLPTSLRESVTVLLEELHG
RDAVLIGPAKPRPGAPESAAATPGGAR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgcccacaaccatgccggcggtgagcgaccagaccagcgacgagcggttctggaa
ggccccgagatctcccgggcgctgacccgcatcgcccacgagatcctcgaacgcaccaaa
gggggccacgacctcacccttctgggcatccgcaccggaggcgtgcccctcgcgcagcgg
ctcgccgaacgcatcgaacgcgtcgaacagcgcccggtcccctggggcgccctcgacatc
accatgtaccgcgacgacctgcggctcgccccggcccgcgccctcggcagcaccgacatt
ccccccgaaggcgtcgacgggcggaccgtagtcctcgtcgacgacgtgctcttctccggc
cgcacggtccgcgccgccctggacgccctcaacgacctgggacgcccgcgcgccgtgcaa
ctggcggtcctcgtcgaccgcggccaccgggaactccccatccgcgccgactacgtgggg
aagaacctgcccacctcgctccgcgaaagcgtcaccgtgctgctcgaagaactccacggg
cgcgacgcggtcctcatcggccccgccaagccccgtcccggagcgcccgagtccgccgca
gccaccccgggaggagcacgctga

DBGET integrated database retrieval system