KEGG   Thermobifida fusca: Tfu_1055Help
Entry
Tfu_1055          CDS       T00265                                 

Definition
(GenBank) dihydroorotase
  KO
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
tfu  Thermobifida fusca
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tfu_1055
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Tfu_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1232134..1233429
Genome map
AA seq 431 aa AA seqDB search
MTTTTRYLIRNARILGGEPTDLLLAHGRIDAIGPDLPADGAEVVDAAGAIALPGLVDLHT
HLREPGREDAETVATGSRAAAMGGYTAVFAMANTDPVADTAGVVEQVWRLGRDAGYCDVH
PVGAVTVGLKGERLAELGAMADSPAKVRVFSDDGMCVSDAQLMRRALEYVKAFDGVIAQH
AQEPRLTEGAQMNEGVVSDRLGLAGWPAVAEEAIIARDCLLAEHVGSRLHVCHVSTKGSV
QIIRWAKSRGCDVTAEVTPHHLLLTDELAESYDPVYKVNPPLRTAEDVEALREGLADGTI
DIVATDHAPHPSEAKETEWNQAAMGMIGLETALSVVQHTMVDTGLLDWAGVAQRMSATPA
RIGRLTDQGRPIAVGEPANLTLYDPTATRVIDPATMVSKSRNTPFAGMTLPGRVLATFLR
GVPTVLDGKIQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccacgcgctacctgatccgcaacgcccgcatcctcgggggcgagcccacc
gacctgctgctcgcccacggccgtatcgacgcgatcggccccgacctccccgctgacggc
gccgaagtggtcgacgccgccggggccattgccctgcccggactcgtcgacctccacacc
cacctgcgggagcctggacgcgaagacgcagaaaccgtcgccaccgggtcgcgggccgcc
gccatgggcggctacaccgccgtcttcgccatggccaacaccgaccccgtcgccgacact
gccggcgtcgtcgaacaggtctggcggctgggccgggacgccggatactgcgacgtccac
ccggtcggggcggtcaccgtcggcctgaaaggcgaacgcctcgccgaactcggcgccatg
gcggactccccggccaaagtccgggtcttctccgacgacggcatgtgcgtctccgacgcc
cagctcatgcgccgcgccctggaatacgtcaaagcgttcgacggcgtcatcgcccagcac
gcccaagaaccgcgcctcaccgaaggcgcccagatgaacgaaggcgtcgtctccgaccgc
ctggggctcgccggctggcccgccgtcgccgaagaagcgatcatcgcccgggactgcctg
ctcgccgagcacgtcggctcgcggctgcacgtctgccacgtctctaccaaggggtcggtg
cagatcatccgctgggccaagagccgcggctgcgacgtcaccgccgaagtgaccccgcac
cacctgctgctcaccgacgagctcgccgagagctacgacccggtctacaaggtcaacccg
cccctgcgcaccgcggaagacgtcgaagcgctgcgtgaaggactggcggacggcacgatc
gacatcgtcgccaccgaccacgccccccaccccagcgaagccaaagaaaccgagtggaac
caggccgccatgggcatgatcggcctggaaaccgcgctgtcggtggtccagcacaccatg
gtcgacaccggcctcctcgactgggccggagtggcgcagcgcatgtccgccacccccgcc
cgcatcggacgcctcaccgaccagggccgccccatcgccgtgggagaacccgccaacctc
accttgtacgatcccacggcgacgcgcgtgatcgaccctgcgacgatggtgtcgaagagc
cgcaacacgcccttcgccggaatgaccctgcccggacgtgtcctcgccaccttcctccgc
ggggtacccaccgttctcgacgggaagattcagtga

DBGET integrated database retrieval system