KEGG   Thermobifida fusca: Tfu_1057Help
Entry
Tfu_1057          CDS       T00265                                 

Definition
(GenBank) carbamoyl-phosphate synthase large subunit
  KO
K01955  
carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
tfu  Thermobifida fusca
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tfu_1057
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tfu_1057
Enzymes [BR:tfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     Tfu_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1234769..1238080
Genome map
AA seq 1103 aa AA seqDB search
MPRRTDLSSVLVIGSGPIVIGQACEFDYSGTQACRVLKAEGLRVILVNSNPATIMTDPEF
ADATYVEPITPEMVEKIIAKERPDALLPTLGGQTALNTAVALHEAGVLDKYGVELIGANI
DAIQAGEDRDSFKRVVERVGGESARSVICHSIEECLAAAEELNYPVVVRPSFTLGGAGSG
FAHNEEELRRIAGQGLALSPTTEVLLEESILGWKEYELELMRDANDNVIVVCSIENLDPM
GVHTGDSITVAPAMTLTDREYQRLRDLGIAIIREVGVDTGGCNIQFAVHPETGRTIVIEM
NPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEITNDITAKTLASFEPTLDYVVVKVPR
FAFEKFPGADSGLTTTMKSVGEVMAIGRSFPEALQKAMRSLEKKGSSFTWTGDPGDKEEL
LRAVRTPSEHRLRQVQQALRAGATVAELHEATKIDPWFLDQILRLDEKARELAAAPRLDA
DLLRSAKQLGFSDAQIGEITGRSEEVVRELRDALDVHPVYLAVDTCAAEFPATTPYLYSS
YDEETEVPPSSKPKVIILGSGPNRIGQGVEFDYSCVHASFALSEAGYETVMVNCNPETVS
TDYDTSDRLYFEPLTLEDVLEVVRAEQQTGEVVGVIVQLGGQTPLGLAKKLKEAGVPIVG
TSPEAIDLAEDRGEFGRVLAKAGLPAPKHGTAQSFDEARAIAEEIGYPVLVRPSYVLGGR
GMEIVYNEAMLADYIERNAEVSAEHPVLVDRFLDEAIEIDVDALYDGTELYLGGVMEHIE
EAGIHSGDSACALPAITLGQEDIERIRYSTEAIAAGVGVRGLINVQYALSAGELYVLEAN
PRASRTVPFVSKATAVPLAKAAARIMLGATIQELRDEGLLPRHGDGGTLPPDAPVAVKEA
VLPFNRFIDRHGQGVDTVLGPEMRSTGEVMGLDVDFGTAFAKSQLATYGTFPTSGTVFVS
VANRDKRTMIFPVRRLADLGFEILATEGTALALRRHGVQARVVRKHSEGPGPDGEPTIVQ
RIHNGEVDLIVNTPFGGPGQSGPRLDGYEIRTAAVARGVPSVTTVQGLAAAVQAIESLVN
GRIQVRSLQEHAQRLRDASQATA
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccgtactgatctttcgtctgtgctcgtgatcggctccgggccgatcgtcatc
ggccaggcgtgcgaattcgactactcgggcactcaggcgtgccgggtgctcaaagccgaa
gggctgcgggtgatcctggtcaactccaacccggccacgatcatgaccgaccccgaattc
gcggacgccacctacgtggaacccatcaccccggagatggtcgagaagatcatcgccaag
gagcgtcccgatgcgctgctgcccaccctgggcggccagaccgcgctcaacaccgcggtg
gcgctgcacgaggccggggtgctcgacaagtacggggtcgaactgatcggcgccaacatc
gacgccatccaggccggggaagaccgcgacagcttcaaacgcgtcgtggagcgggtcggt
ggcgagtcggcccgctcggtgatctgccactccatcgaagagtgcctggccgccgccgaa
gaactgaactatccggtcgtggtccgcccctccttcaccctgggcggcgccggctccggg
ttcgcccacaacgaggaggagctgcgccgcatcgcggggcaagggctcgcgctctccccg
accaccgaggtgctccttgaggagtccatcctcggctggaaggaatacgagctggagctg
atgcgcgacgccaacgacaacgtgatcgtcgtctgctccatcgagaacctcgaccccatg
ggcgtgcacaccggcgactccatcacggtcgcccccgcgatgacgctcaccgaccgcgaa
taccagcggctgcgcgacctggggatcgccatcatccgcgaagtcggggtcgacaccggc
ggctgcaacatccagttcgcggtccaccccgagaccgggcggaccatcgtcatcgagatg
aacccgcgcgtctcccggtcctcggcgctggcgtccaaagccaccgggttccccatcgcg
aagatcgcggccaagctcgccgtcggctacaccctcgacgagatcaccaacgacatcacc
gccaagacgctggccagcttcgagccgaccctggactacgtcgtcgtcaaagtgccgcgg
ttcgcgttcgagaagttccccggcgccgactccggcctgaccaccaccatgaagtcggtc
ggcgaagtcatggcgatcggccggtccttccccgaagcgctgcagaaggccatgcggtcg
ctggagaagaaaggcagctccttcacctggacaggagaccccggggacaaagaggagctg
ctgcgggcggtccggacccccagcgaacaccggctgcgccaagtccagcaggccctgcgg
gccggggccacggtcgcggaactccacgaggccaccaagatcgacccgtggttcctcgac
cagatcctccggttggacgagaaggcccgcgaactcgccgccgcgccccgcctcgacgcg
gacctgctgcgctccgccaaacagctcggcttctccgacgcgcagatcggcgagatcacc
ggccgctccgaagaagtcgtgcgggagctgcgcgacgccctcgacgtgcacccggtctac
ctggccgtggacacctgcgccgccgagttccccgcgaccacgccctacctgtactccagc
tacgacgaggagaccgaggtcccgcccagcagcaagcccaaggtcatcatcctcggctcc
ggacccaaccggatcggccagggcgtggagttcgactacagctgcgtccacgcgtccttc
gccctgtcggaggccggctacgagaccgtcatggtcaactgcaaccctgagacggtctcc
accgactacgacaccagcgaccggctgtacttcgagccgctgaccctggaagacgtgctc
gaagtggtgcgcgccgaacagcagaccggcgaagtcgtcggcgtgatcgtgcaactgggc
ggccagaccccgctcggcctggccaagaagctcaaagaagccggggtgccgatcgtgggc
accagccccgaggcgatcgacctggccgaagaccgcggcgagttcggccgggtcctggcc
aaagccgggctgcccgcccccaagcacggcaccgcccagtccttcgacgaagcccgggcc
atcgccgaagagatcggctacccggtgctggttcgcccctcctacgtgctcggcggccgc
ggcatggagatcgtctacaacgaggccatgctcgccgactacatcgagcgcaacgcggaa
gtcagtgccgaacacccggtgctggtggaccgcttcctcgacgaagccatcgagatcgac
gtggacgccctctacgacggcaccgaactgtacctgggcggtgtcatggagcacatcgag
gaggcgggcatccactccggcgactccgcctgcgctctgcccgcgatcaccctgggccag
gaggacattgaacgcatccgctactccacggaggccatcgccgccggggtgggggtgcgc
ggcctgatcaacgtgcagtacgcgctctccgccggcgaactctacgtgctcgaagccaac
ccgcgggcgtcgcgcaccgtgccgttcgtgtccaaggccaccgcggtccccctggccaag
gctgcagcccggatcatgctgggggcgaccatccaggagctgcgcgacgagggcctgctg
ccgcggcacggcgacggcggcactctgcccccggacgcaccggtcgccgtcaaggaagcg
gtcctgccgttcaaccgcttcattgaccgccacggccagggcgtggacaccgtcctgggc
ccggagatgcgctccaccggtgaagtcatgggcttggacgtggacttcggcaccgcgttc
gccaagtcccaactggccacctacggcacgttccccacgtcgggaaccgtgttcgtctcc
gtggccaaccgcgacaagcgcaccatgatcttcccggtccggcggctggccgacctcggg
ttcgagatcctggccacggaaggcaccgcgctggcgctgcgccgccacggggtgcaggcc
cgcgtggtgcgcaagcacagcgaagggcctggaccggacggggagccgaccattgtgcag
cgcatccacaacggtgaagtggatctcatcgtcaacacgccgttcggcggccccggccag
tccggaccgcgcctggacggctacgagatccgcaccgccgcagtggcgcgcggcgtgccc
agcgtgaccacggtccaaggcctggccgccgccgtgcaagccatcgagtcgctggtcaac
ggcaggatccaggtgcgttcgctccaggagcacgcccagcggctgcgcgacgcatcgcag
gcgaccgcgtag

DBGET integrated database retrieval system