KEGG   Thermobifida fusca: Tfu_1074Help
Entry
Tfu_1074          CDS       T00265                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tfu  Thermobifida fusca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tfu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1254785..1256110)
Genome map
AA seq 441 aa AA seqDB search
MSPRPLRALLGAAAAALVSAAALAFPSQAAANDSPFYVNPNMSSAEWVRNNPNDPRTPVI
RDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVYNAPGRDCGNHSSGGAP
SHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSS
QARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIG
NPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIA
GAGQFVPQAAYEMAIAAGGTNPNPNPNPTPTPTPTPTPPPGSSGACTATYTIANEWNDGF
QATVTVTANQNITGWTVTWTFTDGQTITNAWNADVSTSGSSVTARNVGHNGTLSQGASTE
FGFVGSKGNSNSVPTLTCAAS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccagacctcttcgcgctcttctgggcgccgcggcggcggccttggtcagcgcg
gctgctctggccttcccgtcgcaagcggcggccaatgattctccgttctacgtcaacccc
aacatgtcctccgccgaatgggtgcggaacaaccccaacgacccgcgtaccccggtaatc
cgcgaccggatcgccagcgtgccgcagggcacctggttcgcccaccacaaccccgggcag
atcaccggccaggtcgacgcgctcatgagcgccgcccaggccgccggcaagatcccgatc
ctggtcgtgtacaacgccccgggccgcgactgcggcaaccacagcagcggcggcgccccc
agtcacagcgcctaccggtcctggatcgacgaattcgctgccggactgaagaaccgtccc
gcctacatcatcgtcgaaccggacctgatctcgctgatgtcgagctgcatgcagcacgtc
cagcaggaagtcctggagacgatggcgtacgcgggcaaggccctcaaggccgggtcctcg
caggcgcggatctacttcgacgccggccactccgcgtggcactcgcccgcacagatggct
tcctggctccagcaggccgacatctccaacagcgcgcacggtatcgccaccaacacctcc
aactaccggtggaccgctgacgaggtcgcctacgccaaggcggtgctctcggccatcggc
aacccgtccctgcgcgcggtcatcgacaccagccgcaacggcaacggccccgccggtaac
gagtggtgcgaccccagcggacgcgccatcggcacgcccagcaccaccaacaccggcgac
ccgatgatcgacgccttcctgtggatcaagctgccgggtgaggccgacggctgcatcgcc
ggcgccggccagttcgtcccgcaggcggcctacgagatggcgatcgccgcgggcggcacc
aaccccaacccgaaccccaacccgacgcccacccccactccgacccccacgccgcctccc
ggctcctcgggggcgtgcacggcgacgtacacgatcgccaacgagtggaacgacggcttc
caggcgaccgtgacggtcaccgcgaaccagaacatcaccggctggaccgtgacgtggacc
ttcaccgacggccagaccatcaccaacgcctggaacgccgacgtgtccaccagcggctcc
tcggtgaccgcgcggaacgtcggccacaacggaacgctctcccagggagcctccacagag
ttcggcttcgtcggctctaagggcaactccaactctgttccgacccttacctgcgccgcc
agctga

DBGET integrated database retrieval system