KEGG   Thermobifida fusca: Tfu_1105Help
Entry
Tfu_1105          CDS       T00265                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tfu  Thermobifida fusca
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tfu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tfu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1287604..1289208
Genome map
AA seq 534 aa AA seqDB search
MRPEHVQPRLLSELVPLLGPDAFVTCVDPAEPPLGTAPTPAATDLEQASSVDSVVVTGVT
HDSRAVRPGDLYVAVQGQRVHGAKFAAQAARAGAAAVLTDPAGYDRAAATRLPVITVPDP
RSRLGDVAAWIYGHPARELLLIGTTGTSGKTTVSYLVESGLREAGMRTGLVGTVEIRVDD
ERIDSSLTTPEATELHGLFALMRERDVAGAAMEVSSHALALGRVAGVRYDVAVFTNLSQD
HLDFHADLHDYFETKARLFTPEFAKVAVVNRDDSFGRTLIDRITEQGAIPVTTFSATGDT
AADWYATDVVLEAGGSRFRVVGPGGMAMDASVRLPGPFNVANAMAAIVALIEAGVPLPTA
VAGVAAARGVPGRMERVDEGQDFTAIVDYSHKPGAIEAVLTSLRPITEGRLTIVVGCGGD
RDRGKRPLMGEAAARLADAVILTDDNPRSEDPVTIITSMLEGVAKVPVAQRARITVEPDR
RTAIELAVTRAQPGDVVVVAGKGHERGQHVGDRILPFDDRDVLREAIRARLDTD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccgaacacgtccagccacgtctgctctccgaactcgtcccactgctcggaccg
gacgccttcgttacttgtgtcgaccccgcggagccgcccctgggcaccgcgcccacccct
gccgctactgacctcgaacaggccagcagcgtggactcggtggtggtgaccggtgtcacc
cacgactcccgcgcggtacgccccggggacctgtacgtggccgtccaagggcagcgtgtc
cacggcgctaaattcgccgcccaggcagcccgcgccggcgcggcggctgtgctcaccgac
cccgctggatacgaccgcgccgccgccacccggctgcccgtcatcaccgtgcccgacccc
cgctcccggctcggggacgtggccgcctggatctacggccatccggctcgggaactgctg
ctcatcggcaccaccggaaccagcggcaagaccacggtcagctacctggtggaatccggg
ctgcgcgaggcaggaatgcgcaccggtctggtcggcaccgtggagatccgggtcgacgac
gagcgcatcgactcttccctgaccaccccggaggccaccgaactgcacggcctgttcgcc
ctcatgcgggagcgcgacgtggccggcgccgccatggaagtctccagccacgccctggcc
ctgggccgggtggccggagtgcgctacgacgtcgccgtgttcaccaacctctcccaggac
cacttggacttccacgccgacctgcacgactacttcgaaaccaaagcgcggctgttcact
cccgaattcgccaaagtcgccgtggtcaaccgggacgactccttcgggcggaccctcatc
gaccggatcaccgaacagggcgcgatccccgtcaccacgttctccgccaccggcgacacg
gcagcggactggtatgccaccgacgtcgtgctcgaagcgggcggcagccggttccgggtg
gtcggccccggaggcatggccatggacgcttccgtgcggctgccgggcccgttcaacgtc
gccaacgccatggccgcgatcgtcgccctcatcgaagcgggagtgccgctccccaccgcg
gtggcaggcgtggccgcggcccgcggcgtgccgggccgcatggaacgggtcgacgaagga
caggacttcaccgccatcgtcgactattcgcacaaacccggggcgattgaggcggttctc
acatcgctgcgccccatcaccgaagggcgcctcaccatcgtcgtgggctgcggcggcgac
cgcgaccgggggaaacgcccgctcatgggcgaggcagcggcccgcctggccgacgcggtc
atcctcaccgacgacaacccgcgcagcgaagacccggtcaccattatcaccagcatgctt
gaaggcgtggcgaaagtgcctgtcgcgcagcgcgcccgcatcaccgtggaaccggaccgg
cggaccgcgatcgaactggccgtgacccgtgcccagcccggagacgtcgtggtcgtggcc
ggcaaagggcacgaacgcggccagcacgtgggggaccgcatcctccccttcgacgaccgg
gacgtgctccgcgaagcgatccgcgcccgactcgacaccgactga

DBGET integrated database retrieval system