KEGG   Thermobifida fusca: Tfu_1150Help
Entry
Tfu_1150          CDS       T00265                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tfu  Thermobifida fusca
Pathway
tfu00340  Histidine metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01230  Biosynthesis of amino acids
Module
tfu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Tfu_1150
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Tfu_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AAZ55188
JGI: Tfu1150
UniProt: Q47QS9
Position
1341730..1343046
Genome map
AA seq 438 aa AA seqDB search
MRSVISRIDLRGNPADPRASLPRAEIDVASAVEKVRPICEDVRHRGVEALIELGERFDGV
RPAHIRVPADALETALAGLDRTVRAALEEAIRRARIVHRDQRRTDTTTRVVPGGTVTERW
VPVDRVGLYVPGGRAVYPSSVVMNVVPAQEAGVPSLAVASPPQAEFGGLPHPTILAACAL
LGVDEVYAVGGAQAIAMFAYGAGECAPVSMVTGPGNIWVAAAKRLLKGIIGIDSEAGPTE
IAILADDTANPAYVAADLISQAEHDVVAASVLVTPSTALADRVEAELARQVPAAKHRERI
TQALGGPQSGIVLVDDIDHGLDVVNAYAPEHLEVMTADAQSVAARVRNAGAIFIGDHSPV
SLGDYCAGSNHVLPTGGVAVHSSGLSVQSFLRGIHVVEYDRAALAEVAHHVVALAEAEDL
PAHGAAVTARIPREEQQA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccgtgatctcccgaatcgatcttcgaggcaaccccgcagacccgcgcgcatca
ctgccgcgcgctgagatagacgtcgcgtccgcagtcgaaaaagtccgacccatctgcgaa
gacgtacgccatcgcggggttgaggcgttgatcgagctaggggagcgcttcgacggcgtg
cgccccgcccacatccgggtgcccgccgacgcgctggaaaccgccctcgccggacttgac
cggaccgtgcgcgccgcactggaagaggcgatccgccgggcccgcatcgtccaccgcgac
cagcgccgcaccgacaccaccacccgggtcgtgcccggaggaaccgtcaccgaacgctgg
gtgcccgtcgaccgggtcgggctgtacgtgcccggtggccgtgccgtctacccctccagc
gtggtcatgaacgtcgtgcctgcccaagaagccggggtgccctccctcgccgtggcctcc
ccgccgcaggccgaattcggtggactgccgcaccccaccatcctggcggcctgtgccctg
ctcggcgtagacgaggtgtacgccgtgggcggtgcccaggccatcgccatgttcgcgtac
ggtgcgggcgagtgcgctcccgtcagcatggtgaccggccccggaaacatctgggtcgcc
gccgccaaacgcctcctcaaaggcatcatcggcatcgactccgaggcagggccgaccgag
atcgccatcctcgccgacgacaccgccaaccccgcctacgtggcagcggacctgatcagc
caggccgaacacgacgtcgtcgccgcctcggtcctcgtcaccccgtcaaccgccctcgcc
gaccgcgtggaagccgaactcgcgcgccaggttcccgccgccaagcaccgggaacgcatc
acccaggccctgggcggcccccagtccggcattgtcctcgtcgacgacatcgaccacggc
ctggacgtcgtcaacgcctatgcccccgaacacctggaggtcatgaccgccgacgcccag
tccgttgccgcccgcgtccgcaacgcgggagcgatcttcatcggcgaccactctccggtg
tcgctgggagactactgcgcgggttccaaccacgtgctccccaccggcggggtggccgtc
cactcctcgggactgagcgtgcagagcttcctgcgcggcatccacgtcgtcgaatacgac
cgtgccgcactggccgaagtcgcccaccacgtggtggccctcgccgaagccgaagacctg
cccgcgcacggtgcggctgtcaccgcgcgcatcccccgggaggaacagcaggcgtga

DBGET integrated database retrieval system