KEGG   Thermobifida fusca: Tfu_1165Help
Entry
Tfu_1165          CDS       T00265                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tfu  Thermobifida fusca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tfu_1165
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_1165
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tfu_1165
Enzymes [BR:tfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tfu_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1356074..1357312
Genome map
AA seq 412 aa AA seqDB search
MTTNNTLPVPPYLGEGGHYGRFGGRFSPEALVAALDEVAVAWEKAKNDPDFQAELQRLLT
EYTGRPSPLTEAHNFREHCNGARILLKREDLNHTGSHKINNVLGQALLTKRMGKTRVIAE
TGAGQHGVATATACALLGLECVIYMGEEDTRRQALNVARMRMLGAEVIPVTVGSRTLKDA
VNEAFRDWVTNVETTHYLLGTVAGPHPFPSMVRDLHYIIGAEARQQVLDRTGALPDAVAA
CVGGGSNAIGIFAAFIPDESVRLYGFEAGGDGLDTGRHAASITGGSVGVFQGARTFVLQD
EYGQTVPSHSISAGLDYPAVGPEHAWLAESGRATYAPITDAEAMEAFRLLCRTEGIIPAI
ESAHALAGARKIGAELGPDATILVNVSGRGDKDMTTAATYFGLLDDEGKQDR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaacaacacacttcccgtgcctccctacctgggtgagggcgggcactatggc
cggttcggcggccggttcagcccagaggccctggtcgccgcgctcgacgaggtcgccgtg
gcctgggagaaagcgaagaacgacccggacttccaggcggaactgcagcgtctcctcacc
gagtacacgggccgccccagcccgctcaccgaagcccacaacttccgcgagcactgcaac
ggggcccggatcctgctcaaacgtgaagacctcaaccacacgggctcgcacaagatcaac
aacgtgctcggccaggcgctgctcaccaagcgcatgggcaagacccgggtgatcgccgag
accggggccgggcagcacggcgtggccaccgccaccgcgtgcgcgctgctcggactggaa
tgcgtgatctacatgggcgaggaagacacacgccggcaagccctcaacgtcgcccgcatg
cgcatgctcggcgccgaagtcatcccggtcaccgtgggcagccggaccctcaaagacgcg
gtcaacgaggccttccgggactgggtgacgaacgtcgagaccacccactacctgctgggg
acggtcgccggaccgcacccgttcccgtccatggtccgcgacctgcactacatcatcggc
gcagaagcgcgccagcaggtcctggaccgcaccggggccctcccggacgcggtcgccgcc
tgtgtcggcggcggctccaacgccatcgggatcttcgcggcgttcatccccgacgagtcc
gtgcggctgtacgggttcgaagcgggcggcgacggcttggacacgggacgccacgccgct
tccatcaccggcggaagcgtcggcgtcttccaaggcgcccgcaccttcgtcctgcaggac
gaatacggacagaccgtgcccagccactccatttccgccgggctcgactatcccgcggtc
ggccccgagcacgcctggctggccgagagcggacgcgccacctacgctccgatcacggat
gcggaagccatggaagcgttccgcctgctgtgccgcaccgaaggcatcatcccggcgatt
gaaagcgcgcacgcgctcgccggggcccggaagatcggagccgaactgggaccggacgcc
accatcctggtcaacgtgtcgggccgcggcgacaaggacatgacgaccgccgccacctac
ttcgggctgctcgacgacgaggggaagcaggaccgatga

DBGET integrated database retrieval system