KEGG   Thermobifida fusca: Tfu_1166Help
Entry
Tfu_1166          CDS       T00265                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tfu  Thermobifida fusca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tfu_1166
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_1166
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tfu_1166
Enzymes [BR:tfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tfu_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1357309..1358121
Genome map
AA seq 270 aa AA seqDB search
MTVLRRKLAEAKAEGRAALVGYYPAGFPDVASSIRVVQAMVAGGCDVIEVGFPYSDPTMD
GPVIQQAADRALAAGTTPKDVLAVVRAVADAGAAALVMSYWNPIEKYGVDAFAADLAAAG
GSGLITPDLIPEEAEPWIKASDAAGIDRIFLVAPSSTDERLAKTCAASRGFVYAASLMGV
TGTRDKVAATARRLVERTRAVTRDSGLPICVGLGISNGAQAAEVASYADGVIVGTGFCQR
VLDAPDVDTACQQVRDFAAELAAGVRAAAR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgttgcgccgcaaactcgccgaagccaaagcagaagggcgagccgcactggtc
ggctactacccggccggtttccccgacgtcgcgtcctccatccgggtcgtccaagccatg
gtggcgggcggctgcgacgtgatcgaagtagggttcccctactccgaccccaccatggac
ggccccgtgatccagcaggccgctgaccgggcgctcgccgcgggcaccacccctaaggac
gtgctcgccgtggtgcgcgccgtcgccgacgccggggccgcggccctcgtcatgtcctac
tggaaccccatcgaaaagtacggggtggacgcgttcgccgccgacctggccgccgccgga
gggtcgggactcatcaccccggacctgatccccgaagaagccgagccgtggatcaaggcc
agcgacgccgcggggatcgaccggatcttcctggtcgccccgtcctccaccgacgagcgg
ctcgccaagacctgcgcggcgtcccgcggattcgtctacgccgcctcgctgatgggggtg
acggggacccgcgacaaggtggccgcgaccgcgcggaggctcgtggaacgcacccgcgcc
gtcacccgagacagcggactgcctatctgcgtcggactcgggatttccaacggtgcccaa
gccgccgaagtcgcttcctacgccgacggggtcattgtcggcaccggcttctgccagcgg
gttctggacgcgcccgacgtggacaccgcatgccagcaggtccgcgacttcgccgcggaa
ctcgcggcgggggtgcgtgcggccgctcggtga

DBGET integrated database retrieval system