KEGG   Thermobifida fusca: Tfu_1543Help
Entry
Tfu_1543          CDS       T00265                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tfu  Thermobifida fusca
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tfu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tfu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1779426..1780289
Genome map
AA seq 287 aa AA seqDB search
MWQRDVDLVVPLWQGCDDMRVAAGASALARLVATANPRMHIAVSDGRRGAVDGVHHLELI
ARTMRQVRTRMARRNPARVLTLGGDCVSDLAALEHLSRRYPGMAVYWVDAYPDLHTPQSS
PTGLVQGMALRLLLGEGHPHLLGASRLVPSQVKLIGARVAAPEEVEFVRSRRIEVVDTTR
LTVDARSVVAGQQPGSPAYIHLNLGACDPQDFPAVAFPAPVGPRAALLTAAVAAITAHHT
VVGVGVCEYTPAVAHDVTVLQSLLQALRLVDPAPPPQEGAREVPGVL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagcgtgatgtggaccttgtggtgcccctgtggcaagggtgcgacgatatgcgg
gtcgcggctggggcgagcgcgctggcgcggctggtggccacggcaaaccccagaatgcac
atagcggtctctgacggccggcgcggcgctgtcgacggcgtgcaccacctggaattgatc
gcccgcaccatgcggcaggtgcgcacccggatggcccgccgaaacccggcccgagtcctc
accctgggcggggactgcgtctccgacctggcggctctcgagcatttatcccgccgctat
cccggcatggccgtctactgggtggacgcctaccccgacctgcacaccccgcagtcgtcc
cccaccggcctagtgcagggcatggcgctgcggctcctgctcggtgaaggacacccccac
ctgctgggggccagccgtctcgtaccttcccaagtgaagctgataggcgcccgggtggca
gccccggaagaagtggagtttgtccgcagccgacggatcgaggtggtggacaccacccgg
ctcaccgtggacgcacgatcagtagtggccggccagcagccgggctcccccgcctacatc
cacctcaacctcggcgcctgcgacccccaggatttcccggcagtggcgttccccgcgccc
gtgggcccgcgggcagcgttgctcacagcggccgtggcggcgatcaccgcccaccacacc
gtggtgggtgtaggagtgtgcgaatacacgcccgccgtcgcccacgatgtgaccgtgctg
cagtccttgctgcaggcgctcagactcgtggatccagccccaccaccgcaggaaggagcg
cgggaagtccccggcgtgctgtag

DBGET integrated database retrieval system