KEGG   Thermobifida fusca: Tfu_1543Help
Entry
Tfu_1543          CDS       T00265                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00220  Arginine biosynthesis
tfu00330  Arginine and proline metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01130  Biosynthesis of antibiotics
tfu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Tfu_1543
   00330 Arginine and proline metabolism
    Tfu_1543
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Tfu_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Keratin_2_head
Motif
Other DBs
NCBI-ProteinID: AAZ55579
JGI: Tfu1543
UniProt: Q47PP0
Position
1779426..1780289
Genome map
AA seq 287 aa AA seqDB search
MWQRDVDLVVPLWQGCDDMRVAAGASALARLVATANPRMHIAVSDGRRGAVDGVHHLELI
ARTMRQVRTRMARRNPARVLTLGGDCVSDLAALEHLSRRYPGMAVYWVDAYPDLHTPQSS
PTGLVQGMALRLLLGEGHPHLLGASRLVPSQVKLIGARVAAPEEVEFVRSRRIEVVDTTR
LTVDARSVVAGQQPGSPAYIHLNLGACDPQDFPAVAFPAPVGPRAALLTAAVAAITAHHT
VVGVGVCEYTPAVAHDVTVLQSLLQALRLVDPAPPPQEGAREVPGVL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagcgtgatgtggaccttgtggtgcccctgtggcaagggtgcgacgatatgcgg
gtcgcggctggggcgagcgcgctggcgcggctggtggccacggcaaaccccagaatgcac
atagcggtctctgacggccggcgcggcgctgtcgacggcgtgcaccacctggaattgatc
gcccgcaccatgcggcaggtgcgcacccggatggcccgccgaaacccggcccgagtcctc
accctgggcggggactgcgtctccgacctggcggctctcgagcatttatcccgccgctat
cccggcatggccgtctactgggtggacgcctaccccgacctgcacaccccgcagtcgtcc
cccaccggcctagtgcagggcatggcgctgcggctcctgctcggtgaaggacacccccac
ctgctgggggccagccgtctcgtaccttcccaagtgaagctgataggcgcccgggtggca
gccccggaagaagtggagtttgtccgcagccgacggatcgaggtggtggacaccacccgg
ctcaccgtggacgcacgatcagtagtggccggccagcagccgggctcccccgcctacatc
cacctcaacctcggcgcctgcgacccccaggatttcccggcagtggcgttccccgcgccc
gtgggcccgcgggcagcgttgctcacagcggccgtggcggcgatcaccgcccaccacacc
gtggtgggtgtaggagtgtgcgaatacacgcccgccgtcgcccacgatgtgaccgtgctg
cagtccttgctgcaggcgctcagactcgtggatccagccccaccaccgcaggaaggagcg
cgggaagtccccggcgtgctgtag

DBGET integrated database retrieval system