KEGG   Thermobifida fusca: Tfu_1603Help
Entry
Tfu_1603          CDS       T00265                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tfu  Thermobifida fusca
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tfu00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tfu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1850605..1851762)
Genome map
AA seq 385 aa AA seqDB search
MSNYQPTPEDRFSFGLWTVGWRGHNTFGKAVRPQLDPVDVVWKLRELGAYGITFHDDDLL
PPDSTPAERDAIIKRFTRALEESGMTVPMVTTDLFSHPVFRDGGFTSNSRDVRRYALRKV
MRNIDRAAELGARTYVCWGGMDGAEYEPAKNISAALDRLREAFNILCEYVRSKGYNLRFA
LEPKPNEPRGDILLPTIGHAIAFINELDHPEMVGLNPEVGHEQMAGLNFTHGIAQALWHG
KLFHIDLNGQRGIKYDQDLRFGAGDVRDAFFLVNLLESSGYDGPRHFDFKTPRTEDVDGV
WEAARNCMRNYLIFKEKAEAFRADPEVREAMEAARVFELEQSTLAEGETLDDLLAEDINL
DEVAQRGYHFERLDQLALDYLLGVR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactaccagcccacacccgaggaccggttcagcttcggactgtggactgtggga
tggcgcggccacaacaccttcggcaaggccgtacgcccgcaactcgaccccgtcgacgtc
gtctggaaactccgcgaactcggcgcctacggcatcaccttccacgacgacgacctcctc
ccgccggacagcacccccgcggaacgcgacgccatcatcaaacgcttcacccgggcgctc
gaagagagcggcatgaccgtccccatggtcactaccgacctcttcagccaccccgtcttc
cgcgacggcggcttcacctccaacagccgcgacgtgcgccgctacgccctgcgcaaggtc
atgcgcaacatcgaccgcgccgcggaactcggcgcccgcacctacgtgtgctggggcggc
atggacggcgccgaatacgaacccgccaagaacatctccgccgcgctcgaccgcctgcgc
gaagccttcaacatcctgtgcgaatacgtccgcagcaagggctacaacctgcggttcgcc
ctcgaacccaaacccaacgagccccgcggcgacatcctcctgcccaccatcggccacgcc
atcgccttcatcaacgagctcgaccaccccgaaatggtcggcctcaaccccgaagtcggc
cacgaacagatggccggactcaacttcacccacggcatcgcccaagccctctggcacggc
aaactgttccacatcgacctcaacggccagcgcggcatcaaatacgaccaggacctgcgc
ttcggcgccggcgacgtgcgcgacgcgttcttcctcgtcaacctgctggaaagcagtggc
tacgacggaccgcgccacttcgacttcaagaccccgcgcaccgaagacgtcgacggcgtg
tgggaagcggcacgcaactgcatgcgcaactacctcatcttcaaggagaaggctgaagcg
ttccgcgccgaccccgaagtccgcgaagccatggaagccgcccgggtcttcgaactggag
cagtccaccctcgccgaaggggagaccctggacgacctgctcgccgaagacatcaacctg
gacgaagtggcccagcgcggctaccacttcgaacgcctcgaccagctcgccctcgactac
ctcctgggcgtgcgctaa

DBGET integrated database retrieval system