KEGG   Thermobifida fusca: Tfu_1615Help
Entry
Tfu_1615          CDS       T00265                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tfu  Thermobifida fusca
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tfu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1871657..1873648
Genome map
AA seq 663 aa AA seqDB search
MPSPASLWFGGDYNPDQWPEPVWDEDMRLMRQAGVTLATVGVFSWSLLEPEEDRYTFDWL
DRVLDLLHANGISACLATPTASPPPWFTLAHPDALPVTADGVRLTHGSRDTYDVCAPAYR
EASLRITRALAERYAHHPALALWHVHNEYGTHTYGEHAARAFRTWLRGRYGSLATLNDAW
TTAFWGQRYSDWEQIHPPRATQYLPNPAHLLDFRRFLSDAMRGHYCAQRDILRAANPDVP
VTTNFAFGSWVPVDPWRWAADLDLVAVDVYPDATGEAAAHQHAFAADLARSWGRGRPWLL
MEQATGYLGARVRPKAPGEIIRHSLSHVARGSRGAMFFQWRASVGGAEQWHPAMLPHTGA
DSPVFAEVCELGALLGRLAEVQDTRVVEDAAVVWDPESWWALQSPSLPSPDLDYLAAVRQ
VHRVLWRQGRTVAFVSPHSPMPDLPLLVVPLLYLTSAATARFLADYAEQGGILVVTYGSG
TADEHARVWPGGYPGALRDLLGVRALQHYPLDPAVDAVTVCGEDGEYWGRARRWSEELDV
ADAKVVARYADGPFAGRAAVTRVGRGAGQAWYVSCDLEDAGLGKVLSRAGLSGGTATPPA
VEVVHRDSRDEQWVFVLNHGNGPVTGADLGLAVESREVLSGVSGAALVVPAGGVAVLRGP
RRP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtccagcgtctctgtggttcggcggcgactacaaccctgaccagtggccggaa
ccggtctgggacgaggacatgcggctcatgcggcaggccggagtcaccctggccacggtc
ggcgtgttctcctggagcctgctggaacccgaagaagaccgctacaccttcgactggctg
gaccgggtcctggacctgctgcacgccaacgggatcagtgcctgcctcgccaccccgacc
gcgtccccgcccccgtggttcaccctcgcccaccccgacgctctgccggtgactgccgac
ggggtgcggctgacccacggcagccgcgacacctacgacgtgtgcgcccccgcctaccgg
gaggcgtctttacgcatcacccgggcgctcgcggaacgctatgcccaccaccccgcgctg
gcgctgtggcatgtgcacaacgagtacggcacccacacctacggggagcacgctgcccgc
gccttccgcacctggctgcgtggccgctacggcagcctggccacgctcaacgacgcgtgg
accacggcgttttgggggcagcgctattcggactgggagcagatccacccgccgcgcgcc
acccagtacctgcccaacccggcacacctgttggacttccgccgtttcctctccgacgcc
atgcgcggccactactgcgcccagcgcgacatcctgcgggccgccaacccggatgtcccc
gtcaccaccaacttcgcgttcggctcctgggttccggtcgacccgtggcggtgggctgcc
gacctggatctcgtagcggttgacgtctacccggacgccaccggggaggctgcggcccac
cagcacgcgttcgccgctgacctggcccgctcctggggaaggggccggccgtggctgctc
atggagcaggccaccggctatctcggggctcgggtgcggcccaaagctcccggggagatc
atccggcacagtctgagccacgtggcccgcggctcccggggggcgatgttcttccaatgg
cgggcctccgtgggcggagccgaacagtggcatcccgcgatgttgccgcacaccggcgcg
gactcccccgtctttgcggaagtgtgtgagctgggagcactgttgggccgccttgcggaa
gtccaggacacccgggttgtggaggacgcggccgtggtgtgggatcccgagtcctggtgg
gcgctgcagtcgccgtcactcccctcccccgacctggactatctcgccgcagtccggcaa
gtgcaccgggtgctgtggcggcagggacgcacggtcgcgttcgtctccccccactcccct
atgccggatcttcccctgctcgtcgtgccgctgctgtacttgacctccgcggcgactgcg
cgtttcctcgccgactatgcggagcaaggcggcattctcgtggtcacctacggcagtggg
accgcagacgagcatgcgcgggtgtggcctggaggctacccgggggcgctccgcgacctg
ctgggagtgcgtgctctgcagcactatccgctcgatccggcggtcgacgcggtcacggtg
tgcggggaggacggtgaatactgggggcgggcgcgccggtggagtgaagagctcgacgtg
gccgacgctaaggtggtagcacgctatgcggacggcccgttcgcggggcgtgccgcggtc
acgcgggtggggcgcggcgcgggacaggcgtggtacgtctcctgcgatctggaggacgct
gggttggggaaggtcctgtcccgcgccggcctgtccgggggcaccgctactccccccgcg
gtggaagtggtacaccgggattcccgggacgagcagtgggtgttcgtgctcaaccacggc
aacggcccggtgacaggcgccgacctggggctggctgtggagagccgcgaggtgctctcc
ggggtttctggagcggcgctggtcgtccccgcgggaggagtggcggtgctgcgggggccg
cgtcggccgtga

DBGET integrated database retrieval system