KEGG   Thermobifida fusca: Tfu_1627Help
Entry
Tfu_1627          CDS       T00265                                 

Definition
cellulose 1,4-beta-cellobiosidase (EC:3.2.1.4 3.2.1.91)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
K01225  
cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
tfu  Thermobifida fusca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tfu_1627
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tfu_1627
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     Tfu_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1887518..1890514)
Genome map
AA seq 998 aa AA seqDB search
MGALPWWASAVRSSSQFESPYGRTSVLRRPRSRSPLVALTAATCAVALGGTAVPAQADEV
NQIRNGDFSSGTAPWWGTENIQLNVTDGMLCVDVPGGTVNPWDVIIGQDDIPLIEGESYA
FSFTASSTVPVSIRALVQEPVEPWTTQMDERALLGPEAETYEFVFTSNVDWDDAQVAFQI
GGSDEPWTFCLDDVALLGGAEPPVYEPDTGPRVRVNQVGYLPHGPKKATVVTDATSALTW
ELADADGNVVASGQTKPHGADSSSGLNVHTVDFSSYTTKGSDYTLTVDGETSYPFDIDES
VYEELRVDALSFYYPQRSGIEILDSIAPGYGRPAGHIGVPPNQGDTDVPCAPGTCDYSLD
VSGGWYDAGDHGKYVVNGGISVHQIMSIYERSQLADTAQPDKLADSTLRLPETGNGVPDV
LDEARWEMEFLLKMQVPEGEPLAGMAHHKIHDEQWTGLPLLPSADPQPRYLQPPSTAATL
NLAATAAQCARVFEPFDEDFAAECLAAAETAWDAAKANPNIYAPAFGEGGGPYNDNNVTD
EFYWAAAELFLTTGKEEYRDAVTSSPLHTDDEEVFRDGAFDWGWTAALARLQLATIPNDL
ADRDRVRQSVVDAADMYLANVETSPWGLAYKPNNGVFVWGSNSAVLNNMVILAVAFDLTG
DTKYRDGVLEGMDYIFGRNALNQSYVTGYGDKDSRNQHSRWYAHQLDPRLPNPPKGTLAG
GPNSDSTTWDPVAQSKLTGCAPQMCYIDHIESWSTNELTINWNAPLSWIASFIADQDDAG
EPGGEEPGPGDDETPPSKPGNLKASDITATSATLTWDASTDNVGVVGYKVSLVRDGDAEE
VGTTAQTSYTLTGLSADQEYTVQVVAYDAAGNLSTPATVTFTTEKEDETPTPSASCAVTY
QTNDWPGGFTASVTLTNTGSTPWDSWELRFTFPSGQTVSHGWSANWQQSGSDVTATSLPW
NGSVPPGGSVNIGFNGTWGGSNTKPEKFTVNGAVCSIG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgctcccatggtgggcctccgctgtgaggtcatcctcccagttcgaatccccc
tacggaaggacttccgtgcttaggagacccagatctcgatccccccttgtcgccctcacc
gcggcgacttgcgcagtcgcgctcgggggtacggcggttcccgcccaggcagacgaagtc
aaccagattcgcaacggcgacttcagctccggcaccgcaccctggtggggaaccgagaac
atccaactcaacgtcaccgacgggatgctgtgcgtcgacgtccccggcggcaccgtcaac
ccgtgggacgtgatcatcggccaggacgacatccccctcatcgaaggtgagtcctacgcc
ttctccttcactgcctccagcaccgtccccgtctccatccgcgccctggtgcaagagccc
gtggagccgtggaccacccagatggacgagcgtgccctgctcggccccgaggcagaaacc
tacgaattcgtcttcacctccaacgtcgactgggacgacgcccaagtcgccttccagatc
ggcggctccgacgaaccgtggaccttctgcctcgacgacgtcgccctgctcggcggcgcc
gaacccccggtctacgaacccgacaccggaccgcgggtccgcgtcaaccaggtcggctac
ctcccgcacggtcccaagaaggcgaccgtggtcaccgacgccaccagcgcgctcacctgg
gagcttgccgacgccgacggtaacgtggtcgccagcggccagaccaagccgcacggcgcg
gactccagctccgggctcaacgtccacaccgtcgacttcagctcctacaccacgaaggga
agcgactacacgctcaccgtcgacggtgaaaccagctaccccttcgacatcgacgaaagc
gtctacgaggaactgcgcgtcgacgcgctgtcgttctactacccgcagcgcagcggcatc
gagatcctcgactccatcgcccccggctacggacgcccggccggccacatcggcgtgccc
cccaaccagggcgataccgacgtgccgtgcgcgcccggcacctgcgactactccctggac
gtctccggcggctggtacgacgcgggcgaccacggcaaatacgtggtcaacggcggtatc
tcggtgcaccagatcatgagcatctacgagcgctcccagctcgccgacaccgcccagccc
gacaagctggccgactccaccctgcgcctgcccgaaaccggcaacggcgtgcccgacgtg
ctcgacgaagcacgctgggagatggagttcctcctcaagatgcaggtgcccgaaggcgaa
ccgctcgccggcatggcgcaccacaagatccacgacgaacagtggaccgggctgccgctg
ctgccctccgctgacccgcagccgcgctacctgcagccgccgtccaccgcggccacgctg
aacctggccgccaccgccgcccagtgcgctcgcgtgttcgaacccttcgacgaggatttc
gccgccgagtgcctggctgccgcggaaaccgcgtgggacgccgccaaggccaacccgaac
atctacgcgcctgccttcggtgaaggcggcggcccgtacaacgacaacaacgtcaccgac
gagttctactgggccgcggccgaactgttcctcaccaccggcaaggaggagtaccgcgac
gcggtgacctcgtcgccgctgcacaccgacgacgaagaggtcttccgcgacggcgccttc
gactggggatggactgctgcgctggcccgcctccagctggccacgatccccaacgacctc
gccgaccgcgaccgggtgcgccagtccgtggtcgatgccgccgacatgtacctcgccaac
gtcgagaccagcccgtggggcctggcctacaagccgaacaacggcgtgttcgtctggggc
tccaacagcgctgtcctcaacaacatggtgatcctggcggtcgccttcgacctcaccggt
gacaccaaataccgcgacggcgtgctggaaggcatggactacatcttcggccgcaacgcg
ctgaaccagtcctacgtcaccggctacggcgacaaggactcccgcaaccagcacagccgc
tggtacgcccaccagctcgacccccggttgcccaacccgcccaagggcacgctggccggt
ggacccaactccgactccaccacctgggacccggtggcccagtccaagctgaccgggtgc
gccccccagatgtgctacatcgaccacatcgagtcgtggtccaccaacgagctgaccatc
aactggaacgcccccctgtcgtggatcgcgtccttcatcgccgaccaggacgacgccggc
gagcccggcggagaagagcccggaccgggcgacgacgagaccccgccgagcaagcctggg
aacctgaaggccagcgacatcaccgcgaccagcgccaccctgacctgggacgcctccacc
gacaacgtcggagtggtcggctacaaggtctccctggtccgcgacggtgacgctgaagag
gtgggcaccaccgcgcagaccagctacacgctcaccgggctgagcgcggaccaggagtac
accgtccaggtggtcgcctacgacgcggcaggcaacctctccacgccagccaccgtcacc
ttcaccaccgagaaggaggacgagactcccacgcccagcgcctcctgcgcggtgacgtac
cagaccaacgactggccgggcggcttcaccgcctcggtgacgctgaccaacaccggcagc
accccgtgggactcctgggaactgcgcttcaccttcccgtcgggacagactgtcagccac
ggctggagcgccaactggcagcagagcggcagtgacgtgaccgccacctccttgccgtgg
aacggatcagttccgccgggcggctcagtcaacatcggcttcaacggaacctggggcggt
tcgaacaccaaacctgagaagttcaccgtcaacggcgcggtctgctccatcggctga

DBGET integrated database retrieval system