KEGG   Thermobifida fusca: Tfu_1753Help
Entry
Tfu_1753          CDS       T00265                                 

Definition
helicase RecD/TraA (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tfu  Thermobifida fusca
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tfu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2045167..2047377)
Genome map
AA seq 736 aa AA seqDB search
MASGEPFRPAVLEGVLERITYVNEETGYTVARVDTGRGSDLVTVVGALLGAHPGESLRME
GRWTSHPQYGRQFQVENYTTVLPATVQGIRRYLGSGLVKGIGPRLAEHIVNHFGAAALDV
IENSPERLLEVPKLGPKRTKIITEAWEEQKAIKEVMVFLQTVKVSTSLAVRIYKQYGDDA
IRVVREEPYSLAADVWGIGFKTADSIAQAVGIPHDSPQRVKAGIQFTLSEFTNDGHCYLP
EDTLINEAVKILQVDSALVIDCLAELVAEERVVREKVPDRDGESVTAIYLLPFYRAETAL
ANQVRALLHTEHDRLASFATVDWDRALAWLRSQTGAELAPAQEKAVKLALTNKVAVLTGG
PGCGKSFTVASIIKLAAAKRAKIMLAAPTGRAAKRLTELTGYDASTVHRLLELKPGGEAA
YDRDNPLDCDLLVVDEASMLDLLLANKLVKAVPPGAHLLLVGDVDQLPSVGAGQVLRDLL
ADGSPVPSVRLTHVFRQAAQSGVVTNAHRINTGKPLLLEGMTDFYLFPCEDTEAAAELTV
DVVARRIPRRFGLDPRRDIQVLTPMHRGPAGAGNLNMLLQEALTPARPGVAERRVGSRVF
RVGDKVVQIRNNYDKGANGVFNGTLGTVTAIDLDDQTLTVLTDENEEVGYEFTELDELTH
AYALTVHRSQGSEYPCVVVPVTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRRAIAQAIRN
ASSGRRHTALDYRLQR
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccggtgaacccttccgcccggcggtgctggaaggagtgctggaacgcatcaca
tacgtcaacgaggagaccggctacaccgtggcccgcgtcgacacgggacgcggcagtgac
ctggtcaccgtcgtcggcgccctgctcggcgcccatcccggcgaatcgctgcgcatggaa
ggccggtggacctcccacccccagtacgggcggcagttccaggtggagaactacaccacg
gtcctgcccgccaccgtccaggggatccgccgctatctggggtccgggctcgtcaaaggg
ataggcccccgcttggcagaacacatcgtcaaccatttcggggcggcagcgctcgacgtt
atcgaaaactccccggagcggctcctggaagtgccgaaactcggcccgaaacgcacgaaa
atcatcaccgaggcctgggaggagcagaaagccatcaaagaggtgatggtcttcctgcaa
accgtgaaagtgtccacctccctggccgtgcgtatttacaagcagtacggcgacgacgct
attcgcgtggtgcgggaggagccttactcgctcgccgcggatgtgtgggggatcgggttc
aaaaccgcggactcaatcgcccaagccgtcggtattccccacgacagtccgcagcgggtc
aaagccggaatccagttcaccctttccgagttcaccaacgacgggcactgctatctgcct
gaggacactttgatcaacgaggccgtgaaaatcctccaggtggattcggcgctcgtcatc
gactgtctggcggagctggtcgctgaggagagagtggtccgcgaaaaagtccctgaccgg
gacggcgaatcagtgaccgctatctacctgctccccttctaccgtgcggagaccgccctc
gccaaccaggtgcgcgcgctgctgcacaccgaacacgaccggctggcgtctttcgccacc
gtggactgggaccgggccttggcgtggctgcggagccagaccggcgccgagctggccccc
gcccaggaaaaagccgtcaaactcgcgctgaccaacaaggtcgccgtactcaccggcggg
ccggggtgcggcaagtcctttaccgtggcctccatcatcaaactggccgcagccaaacgc
gccaagatcatgctggccgcgcctacgggacgcgccgcaaaacggctcactgaactgacc
gggtatgacgcgtcgaccgtgcaccggctgctggagctcaaacccggcggcgaggccgcg
tacgaccgcgacaacccgcttgactgcgacctgctcgtcgtcgacgaagcgtccatgctt
gacctgctgctcgccaacaagctggtcaaagcggtgccgcccggcgcccacctgctcctt
gtcggcgacgtcgaccagcttccctcagtcggtgcaggccaagtgctccgcgacctgctc
gccgacggttcaccggtgcccagtgtccgcctcacccacgtgttccgacaggccgcccag
tccggggtggtcaccaacgcgcaccgcatcaacaccggcaagcccctcctgttggagggc
atgacggacttctacctcttcccctgcgaggacaccgaagcggccgcggaactgaccgtg
gacgtggtcgcccgccgtatcccccgccggttcgggctggacccgcgccgcgacatccaa
gtactcaccccgatgcaccggggccccgccggggccgggaacttgaacatgctgctccaa
gaagcactcaccccggcccgtccaggcgtggcggaacggcgggttggcagccgggtcttc
cgggtcggcgacaaggtcgtgcagatccgcaacaattacgacaagggcgccaacggcgtg
ttcaacggcaccctcggcacggtgaccgcgatcgacctggacgaccagacgctgaccgtc
ctcaccgacgaaaacgaagaggtcggctacgagttcacggagcttgacgagctcacccac
gcttatgcgttgaccgtgcaccgctcccagggcagtgaatacccgtgcgtggtggtgcca
gtgacgacaagtgcgtggatgatgctgcaacgcaacctgctgtacaccgcggtgacacgc
gcgaagaaactcgtggttttggtcgggtcgcggcgtgctatcgcccaggcgatccggaac
gcgtcctcggggcgccgccataccgcattggactaccggctgcagcggtga

DBGET integrated database retrieval system