KEGG   Thermobifida fusca: Tfu_1753Help
Entry
Tfu_1753          CDS       T00265                                 

Definition
(GenBank) helicase RecD/TraA
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tfu  Thermobifida fusca
Pathway
tfu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tfu_1753
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tfu_1753
DNA repair and recombination proteins [BR:tfu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Tfu_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 Viral_helicase1 HHH_5 Helicase_RecD AAA_11 UvrD_C HHH_2 PIF1 PhoH AAA_22 HTH_IclR AAA_16 DUF87 DAP3
Motif
Other DBs
NCBI-ProteinID: AAZ55788
JGI: Tfu1753
UniProt: Q47P31
Position
complement(2045167..2047377)
Genome map
AA seq 736 aa AA seqDB search
MASGEPFRPAVLEGVLERITYVNEETGYTVARVDTGRGSDLVTVVGALLGAHPGESLRME
GRWTSHPQYGRQFQVENYTTVLPATVQGIRRYLGSGLVKGIGPRLAEHIVNHFGAAALDV
IENSPERLLEVPKLGPKRTKIITEAWEEQKAIKEVMVFLQTVKVSTSLAVRIYKQYGDDA
IRVVREEPYSLAADVWGIGFKTADSIAQAVGIPHDSPQRVKAGIQFTLSEFTNDGHCYLP
EDTLINEAVKILQVDSALVIDCLAELVAEERVVREKVPDRDGESVTAIYLLPFYRAETAL
ANQVRALLHTEHDRLASFATVDWDRALAWLRSQTGAELAPAQEKAVKLALTNKVAVLTGG
PGCGKSFTVASIIKLAAAKRAKIMLAAPTGRAAKRLTELTGYDASTVHRLLELKPGGEAA
YDRDNPLDCDLLVVDEASMLDLLLANKLVKAVPPGAHLLLVGDVDQLPSVGAGQVLRDLL
ADGSPVPSVRLTHVFRQAAQSGVVTNAHRINTGKPLLLEGMTDFYLFPCEDTEAAAELTV
DVVARRIPRRFGLDPRRDIQVLTPMHRGPAGAGNLNMLLQEALTPARPGVAERRVGSRVF
RVGDKVVQIRNNYDKGANGVFNGTLGTVTAIDLDDQTLTVLTDENEEVGYEFTELDELTH
AYALTVHRSQGSEYPCVVVPVTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRRAIAQAIRN
ASSGRRHTALDYRLQR
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccggtgaacccttccgcccggcggtgctggaaggagtgctggaacgcatcaca
tacgtcaacgaggagaccggctacaccgtggcccgcgtcgacacgggacgcggcagtgac
ctggtcaccgtcgtcggcgccctgctcggcgcccatcccggcgaatcgctgcgcatggaa
ggccggtggacctcccacccccagtacgggcggcagttccaggtggagaactacaccacg
gtcctgcccgccaccgtccaggggatccgccgctatctggggtccgggctcgtcaaaggg
ataggcccccgcttggcagaacacatcgtcaaccatttcggggcggcagcgctcgacgtt
atcgaaaactccccggagcggctcctggaagtgccgaaactcggcccgaaacgcacgaaa
atcatcaccgaggcctgggaggagcagaaagccatcaaagaggtgatggtcttcctgcaa
accgtgaaagtgtccacctccctggccgtgcgtatttacaagcagtacggcgacgacgct
attcgcgtggtgcgggaggagccttactcgctcgccgcggatgtgtgggggatcgggttc
aaaaccgcggactcaatcgcccaagccgtcggtattccccacgacagtccgcagcgggtc
aaagccggaatccagttcaccctttccgagttcaccaacgacgggcactgctatctgcct
gaggacactttgatcaacgaggccgtgaaaatcctccaggtggattcggcgctcgtcatc
gactgtctggcggagctggtcgctgaggagagagtggtccgcgaaaaagtccctgaccgg
gacggcgaatcagtgaccgctatctacctgctccccttctaccgtgcggagaccgccctc
gccaaccaggtgcgcgcgctgctgcacaccgaacacgaccggctggcgtctttcgccacc
gtggactgggaccgggccttggcgtggctgcggagccagaccggcgccgagctggccccc
gcccaggaaaaagccgtcaaactcgcgctgaccaacaaggtcgccgtactcaccggcggg
ccggggtgcggcaagtcctttaccgtggcctccatcatcaaactggccgcagccaaacgc
gccaagatcatgctggccgcgcctacgggacgcgccgcaaaacggctcactgaactgacc
gggtatgacgcgtcgaccgtgcaccggctgctggagctcaaacccggcggcgaggccgcg
tacgaccgcgacaacccgcttgactgcgacctgctcgtcgtcgacgaagcgtccatgctt
gacctgctgctcgccaacaagctggtcaaagcggtgccgcccggcgcccacctgctcctt
gtcggcgacgtcgaccagcttccctcagtcggtgcaggccaagtgctccgcgacctgctc
gccgacggttcaccggtgcccagtgtccgcctcacccacgtgttccgacaggccgcccag
tccggggtggtcaccaacgcgcaccgcatcaacaccggcaagcccctcctgttggagggc
atgacggacttctacctcttcccctgcgaggacaccgaagcggccgcggaactgaccgtg
gacgtggtcgcccgccgtatcccccgccggttcgggctggacccgcgccgcgacatccaa
gtactcaccccgatgcaccggggccccgccggggccgggaacttgaacatgctgctccaa
gaagcactcaccccggcccgtccaggcgtggcggaacggcgggttggcagccgggtcttc
cgggtcggcgacaaggtcgtgcagatccgcaacaattacgacaagggcgccaacggcgtg
ttcaacggcaccctcggcacggtgaccgcgatcgacctggacgaccagacgctgaccgtc
ctcaccgacgaaaacgaagaggtcggctacgagttcacggagcttgacgagctcacccac
gcttatgcgttgaccgtgcaccgctcccagggcagtgaatacccgtgcgtggtggtgcca
gtgacgacaagtgcgtggatgatgctgcaacgcaacctgctgtacaccgcggtgacacgc
gcgaagaaactcgtggttttggtcgggtcgcggcgtgctatcgcccaggcgatccggaac
gcgtcctcggggcgccgccataccgcattggactaccggctgcagcggtga

DBGET integrated database retrieval system