KEGG   Thermobifida fusca: Tfu_1811Help
Entry
Tfu_1811          CDS       T00265                                 

Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
tfu  Thermobifida fusca
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tfu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tfu00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tfu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2111660..2112448
Genome map
AA seq 262 aa AA seqDB search
MASRGRVGLGIDIGGSGIKGAPVDLDRGTFVVDRVKIATPQPATPEAVAAVVAEIVTAFA
DDVPQDAPLGVTFPAVIQHGVARSAANVDRSWIGTNVEELLSAVTGRRVLVVNDADAAAM
AEHRYGAASGVDGVVLLTTLGTGIGTAVLVDGVLLPNTEFGHLEIDGYDAETRASASAKE
RENLSYKEWAEERLQRYYSVIEDLLWPDLIVVGGGVSRKADKFLPHLRLRAPIVPAKLRN
TAGIVGAAVLAAERLGGDRVSA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcggggacgggtcgggctggggattgacatcgggggaagcgggatcaaaggc
gcccctgtggacttggaccggggaacgttcgtggtggaccgggtcaagatcgctactccg
cagcccgcaacccctgaggcggtggctgcggtggtggcggagatagtcaccgcgttcgcc
gacgatgtgccgcaggatgcaccgttgggggtgacgtttcccgcggtgatccagcacggg
gtggcgcgcagcgccgccaacgtggaccgctcgtggatcggcaccaacgtcgaggagctg
ctgtctgcggtgacggggcggcgggtgctggtggtcaacgacgctgacgccgcagcgatg
gcggagcaccgctacggcgctgcctcaggcgtcgacggggtggtgctgttgactactttg
ggtaccggtattggtacggcggtgctagtggacggggtgctgctccccaacacggagttc
gggcacttggagatcgacggctacgacgctgagacccgggcctctgctagcgctaaggag
cgcgagaacctctcctacaaggagtgggctgaggagcggctgcagcgctactactcggtg
atcgaggatttgctgtggccggacttgatcgtggtgggcggcggggtcagccgcaaggcg
gacaagtttttgccgcatctccgcttgcgcgcgccgatcgtgccggcgaagttgcgcaat
accgcggggatcgtgggtgcggccgtgctggccgcggagcggctggggggtgaccgggtc
tctgcctga

DBGET integrated database retrieval system