KEGG   Thermobifida fusca: Tfu_1819Help
Entry
Tfu_1819          CDS       T00265                                 

Definition
(GenBank) ATPase components of various ABC-type transport systems contain duplicated ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
tfu  Thermobifida fusca
Pathway
tfu02024  Quorum sensing
Module
tfu_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Tfu_1819
Transporters [BR:tfu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Tfu_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_22 AAA_16 DUF3987 AAA_33 DUF87 MMR_HSR1 ATP-synt_ab RsgA_GTPase PRK NB-ARC AAA_23 NACHT
Motif
Other DBs
NCBI-ProteinID: AAZ55852
JGI: Tfu1819
UniProt: Q47NW7
Position
complement(2119517..2121298)
Genome map
AA seq 593 aa AA seqDB search
MSTPETGSQGNGLPVVSVRDLSITFSTDDGDVHAVQNLSFEVAEGEALGIVGESGSGKSV
TSLALMGLHRDTRAQLSGEIRVAGIDVVTASDQEIRAMRGNDIAMVFQDPMSSLHPQYTI
GNQIIEAYLTHRPTASRAEARRRAIDVLDRVGIPEPAKRINSYPHEFSGGMRQRVLIAMG
LVCEPKVLLADEPTTALDVTVQAQILDLLDELRRDLRMALILVSHDLAVVAGSVDNVLVM
RKGVAVERGDVRQVLNSPSHPYTQQLLAAVPRIEISRAQRRAQLRAEREGKTTPAAAETP
APSQRSTDEEPLLSVRNVRQRFRIRGGLFGGATDFYAVDGVSFDLYRGETLGIVGESGSG
KSTLSRMIMRLLEPTEGTILFQGRDITHLPERKMRPLRRDIQMVFQNPYSSLNPRMTIGD
SIGAPLRIQGERDDKLIRTRVQELLERVGLEPSHYNRFPHAFSGGQRQRIAIARALILRP
QLVICDEPVSALDVSTQDQVLRLLAELQEDFNLTLIFVAHDLAVVRQISDRVLVMRKGKV
VETGDSDEVYENPQHPYTKQLLAAAPVLDPDAARAHRAERRRLRAAQPDTDVA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccggaaaccggaagccaaggcaatgggcttcccgttgtctccgtgcgcgac
ctttccatcaccttctccactgacgacggcgacgtccacgccgtccagaacctgtccttc
gaagtcgccgaaggtgaagcgctaggcatcgtgggcgagtccggttccggtaagagcgtc
acctccctggcgctgatgggcttgcaccgcgacacccgggcacagctctccggggagatc
cgcgtcgctggaatcgacgtggtcaccgccagcgaccaggagatccgcgcgatgcgcggc
aacgacatcgccatggtcttccaagacccgatgtcctccctgcacccgcagtacaccatc
gggaaccagatcatcgaggcctacctcacccaccgccccacagcgagccgggctgaggca
cggcggcgcgccatcgacgtgcttgaccgggtcggcatccccgaaccggcgaaacgcatc
aactcctatccgcacgaattctccggcgggatgcggcagcgcgtcctcattgccatgggc
ctggtgtgcgaaccgaaagtgctgctcgccgacgagcccaccacggccctggacgtcacc
gtgcaagcgcagatcctcgaccttctcgacgagctgcgccgcgacctgcgcatggcgctc
atcctcgtcagccacgacctggccgtggtcgctggatcagtcgacaacgtcctcgtcatg
cgcaaaggcgtggcagtggaacgcggcgacgtgcgtcaggtgctcaactctccgagccac
ccctacacccagcaactgctcgccgccgtgccccggatcgagatctcccgggcccagcgc
cgtgcccaactgcgtgccgaacgcgaagggaaaaccaccccggccgccgcggaaacgcct
gcgccgagccagcgcagcaccgatgaggagccgctgctgagcgtgcgcaacgtgcgccag
cggttccgtatccgcggcggcctcttcggcggcgccaccgacttctacgcggtcgacggc
gtctccttcgacctgtaccgcggcgaaaccctgggcattgtcggcgagtccggttccggt
aaaagcaccctgtcccgcatgatcatgcggctgttggagcccaccgaaggcaccatcctc
ttccaaggccgggacatcacccacctgccggaacgcaagatgcgcccgctgcgccgcgac
atccagatggtcttccaaaacccctactcgtccctcaacccccggatgaccatcggcgac
agcatcggcgcacccctgcgcatccaaggggaacgcgacgacaaactgatccgcacccgc
gtccaggaactgctggaacgggtcggactcgaaccgtcccactacaaccgcttcccgcac
gccttctccggtgggcagcgccagcgcatcgccatcgcccgggccctgatcctccgcccc
caactggtgatctgcgacgaaccggtctccgcgctggacgtctccacccaagaccaggtg
ctgcggctgctcgcggaactgcaagaagacttcaacctgacgttgatcttcgtggcacac
gacctggccgtggtccgccagatcagcgaccgcgtcctcgtcatgcgcaaaggcaaagtc
gtggagaccggcgacagcgacgaggtgtacgagaacccgcagcacccctacaccaagcag
ctgctggctgccgcccccgtcctcgacccggacgcggcccgcgctcaccgcgctgaacgc
cgccggctccgcgccgcgcagccggacaccgacgtcgcctga

DBGET integrated database retrieval system