KEGG   Thermobifida fusca: Tfu_1819Help
Entry
Tfu_1819          CDS       T00265                                 

Definition
ABC transporter ATPase
Orthology
K02031  
peptide/nickel transport system ATP-binding protein
K02032  
peptide/nickel transport system ATP-binding protein
Organism
tfu  Thermobifida fusca
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2119517..2121298)
Genome map
AA seq 593 aa AA seqDB search
MSTPETGSQGNGLPVVSVRDLSITFSTDDGDVHAVQNLSFEVAEGEALGIVGESGSGKSV
TSLALMGLHRDTRAQLSGEIRVAGIDVVTASDQEIRAMRGNDIAMVFQDPMSSLHPQYTI
GNQIIEAYLTHRPTASRAEARRRAIDVLDRVGIPEPAKRINSYPHEFSGGMRQRVLIAMG
LVCEPKVLLADEPTTALDVTVQAQILDLLDELRRDLRMALILVSHDLAVVAGSVDNVLVM
RKGVAVERGDVRQVLNSPSHPYTQQLLAAVPRIEISRAQRRAQLRAEREGKTTPAAAETP
APSQRSTDEEPLLSVRNVRQRFRIRGGLFGGATDFYAVDGVSFDLYRGETLGIVGESGSG
KSTLSRMIMRLLEPTEGTILFQGRDITHLPERKMRPLRRDIQMVFQNPYSSLNPRMTIGD
SIGAPLRIQGERDDKLIRTRVQELLERVGLEPSHYNRFPHAFSGGQRQRIAIARALILRP
QLVICDEPVSALDVSTQDQVLRLLAELQEDFNLTLIFVAHDLAVVRQISDRVLVMRKGKV
VETGDSDEVYENPQHPYTKQLLAAAPVLDPDAARAHRAERRRLRAAQPDTDVA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccggaaaccggaagccaaggcaatgggcttcccgttgtctccgtgcgcgac
ctttccatcaccttctccactgacgacggcgacgtccacgccgtccagaacctgtccttc
gaagtcgccgaaggtgaagcgctaggcatcgtgggcgagtccggttccggtaagagcgtc
acctccctggcgctgatgggcttgcaccgcgacacccgggcacagctctccggggagatc
cgcgtcgctggaatcgacgtggtcaccgccagcgaccaggagatccgcgcgatgcgcggc
aacgacatcgccatggtcttccaagacccgatgtcctccctgcacccgcagtacaccatc
gggaaccagatcatcgaggcctacctcacccaccgccccacagcgagccgggctgaggca
cggcggcgcgccatcgacgtgcttgaccgggtcggcatccccgaaccggcgaaacgcatc
aactcctatccgcacgaattctccggcgggatgcggcagcgcgtcctcattgccatgggc
ctggtgtgcgaaccgaaagtgctgctcgccgacgagcccaccacggccctggacgtcacc
gtgcaagcgcagatcctcgaccttctcgacgagctgcgccgcgacctgcgcatggcgctc
atcctcgtcagccacgacctggccgtggtcgctggatcagtcgacaacgtcctcgtcatg
cgcaaaggcgtggcagtggaacgcggcgacgtgcgtcaggtgctcaactctccgagccac
ccctacacccagcaactgctcgccgccgtgccccggatcgagatctcccgggcccagcgc
cgtgcccaactgcgtgccgaacgcgaagggaaaaccaccccggccgccgcggaaacgcct
gcgccgagccagcgcagcaccgatgaggagccgctgctgagcgtgcgcaacgtgcgccag
cggttccgtatccgcggcggcctcttcggcggcgccaccgacttctacgcggtcgacggc
gtctccttcgacctgtaccgcggcgaaaccctgggcattgtcggcgagtccggttccggt
aaaagcaccctgtcccgcatgatcatgcggctgttggagcccaccgaaggcaccatcctc
ttccaaggccgggacatcacccacctgccggaacgcaagatgcgcccgctgcgccgcgac
atccagatggtcttccaaaacccctactcgtccctcaacccccggatgaccatcggcgac
agcatcggcgcacccctgcgcatccaaggggaacgcgacgacaaactgatccgcacccgc
gtccaggaactgctggaacgggtcggactcgaaccgtcccactacaaccgcttcccgcac
gccttctccggtgggcagcgccagcgcatcgccatcgcccgggccctgatcctccgcccc
caactggtgatctgcgacgaaccggtctccgcgctggacgtctccacccaagaccaggtg
ctgcggctgctcgcggaactgcaagaagacttcaacctgacgttgatcttcgtggcacac
gacctggccgtggtccgccagatcagcgaccgcgtcctcgtcatgcgcaaaggcaaagtc
gtggagaccggcgacagcgacgaggtgtacgagaacccgcagcacccctacaccaagcag
ctgctggctgccgcccccgtcctcgacccggacgcggcccgcgctcaccgcgctgaacgc
cgccggctccgcgccgcgcagccggacaccgacgtcgcctga

DBGET integrated database retrieval system