KEGG   Thermobifida fusca: Tfu_1897Help
Entry
Tfu_1897          CDS       T00265                                 

Definition
UDP-galactopyranose mutase (EC:5.4.99.9)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tfu  Thermobifida fusca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tfu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2221522..2222955)
Genome map
AA seq 477 aa AA seqDB search
MDTTPHTVVVGGGVSGLAVAHRLARSGHRVTVLEAAARPGGKLAVEKVAGVSADVGAEAV
LARRPEALSLIDELGLTERVTHPGTVTSQIYSRGKLRDFPEGHVMGVPSDFAALARSGVL
SPLGVLRAARDLVWPATPVKADVPVATYIGIRMGRETVDRLVEPLLGGVYAGRADQLSLD
ATLPQLASAARTQRSLAAIARDTHSRTARPTAEPPPPLFATLRGGLATLIDALAAQPGVT
VRTATPARDLRRTEQGWQLAVGDPPAETVDADAVVLACPAPEAARLLRTIAPSAAVELGG
VRYASMAVVTLAYPLSAFPAPPTASGFLVPSVEGRTIKAVTFSSVKWPWLAAELRDANPG
EEIVLLRCSLGRFGDDAVVDYDDDTLVARATSDLADLCGVSGPPVDSHVTRWNAGLPQYT
VGHRDRVARIRSALDGIDGLAVCGAVYNGVGIPACLSSAEEAARRITHTTGGQRSHR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggacaccacaccacacaccgtggtggtcggtggcggcgtgtccggtctggccgtcgca
caccggctcgcccgcagcggacaccgcgtcaccgtgctggaagccgcggcacggcccggc
ggcaaactcgcggtggagaaagtcgcaggggtctccgccgacgtcggcgcggaagcagtc
ctggcccgccgtcccgaggcgctctccctcattgacgaactcggtctcaccgagcgggtc
acccacccaggaaccgtgacctcgcagatctacagtcgcggcaagctccgggacttcccg
gaaggccatgtcatgggagtgcccagcgacttcgcggccctagcccgcagcggggtgctc
tccccgctcggcgtgctgcgcgccgcccgcgacctcgtctggcccgccacccccgtcaag
gcggacgtcccggtcgccacctacatcgggatccggatgggccgcgaaaccgtcgaccgt
ctcgtggaaccgctcttgggcggtgtctacgcgggccgcgccgaccaactgtccctggac
gccaccctgccgcagctcgcctcggccgcccgcacccagcggtccctggcagcgatcgca
cgcgacacacactcccggaccgcccgcccgaccgcagagccaccgcctccgctcttcgcc
accttgcgcggcggcctggccaccctgatcgacgcccttgccgcacagccaggcgtcacc
gtccggaccgccaccccggcccgggacctgcgccgcaccgagcaggggtggcaactggcc
gtgggcgacccgcctgccgaaacggtcgatgccgacgcggtcgtgctggcctgccccgcg
ccggaggcggcacgcctgctgcgcacgatcgccccgagcgccgcagtggaactgggcggt
gtccgctacgcgagcatggccgtggtcaccctcgcctacccgctctccgcgttccccgcc
ccgcctaccgccagcggattcctggtgcccagcgtggaaggccgcaccatcaaagcggtg
accttcagcagtgtgaagtggccgtggctcgccgcggagctgcgcgacgccaacccgggg
gaagagattgtgctgctgcgctgctcgctcggccggttcggcgacgacgcagtcgtggac
tacgacgacgacacgctggtggcccgggccaccagcgaccttgcagacctgtgcggggtg
tccggaccgccagtggacagccacgtcacccgctggaacgccggactcccccagtacacg
gtgggccaccgcgatcgggtcgcccggatccggtcggccctggacggtatcgacgggctc
gccgtgtgcggcgccgtctacaacggcgtgggtatccccgcgtgcctcagcagtgctgaa
gaggccgcgcgccgtatcactcacacaaccggaggacaaaggagtcacaggtga

DBGET integrated database retrieval system