KEGG   Thermobifida fusca: Tfu_2015Help
Entry
Tfu_2015          CDS       T00265                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tfu  Thermobifida fusca
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tfu_2015 (tpiA)
   01230 Biosynthesis of amino acids
    Tfu_2015 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_2015 (tpiA)
   00051 Fructose and mannose metabolism
    Tfu_2015 (tpiA)
   00562 Inositol phosphate metabolism
    Tfu_2015 (tpiA)
Enzymes [BR:tfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tfu_2015 (tpiA)
Exosome [BR:tfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tfu_2015 (tpiA)
  Exosomal proteins of bladder cancer cells
   Tfu_2015 (tpiA)
  Exosomal proteins of melanoma cells
   Tfu_2015 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2354873..2355658)
Genome map
AA seq 261 aa AA seqDB search
MATAKRKPLIAGNWKLNNNHLEAIALVQKMAFALNDADYDAADIAVLPPFTAIRSVQTLV
EGDKLRITYGAQDISQHEKGAYTGEVSGPMLAKLNCTYALAGHSERREYHHEDDAVVNAK
VKAAFASGITPILCLGEGLEVRKAGRHVEHTLAQLEGALKGVTEEQVRTLVVAYEPVWAI
GTGEVATPEDAQEVCAALRKRIGELYSPEAAQQTRILYGGSVKSGNVAAIMAQADVDGAL
VGGASLDADEFVKLIRAAVQG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgccaagcgcaagccgctgattgcgggtaactggaagctgaacaacaaccac
ctcgaggccatcgcgctggtgcagaagatggccttcgccctcaacgacgccgactacgac
gccgcagacatcgcggttctgccgccgttcaccgcgatccgcagcgtgcagaccctggtg
gaaggggacaaactgcggatcacctacggtgcccaggacatctcccagcacgagaagggc
gcctacaccggtgaagtgtccggcccgatgctggccaaactcaactgcacgtacgcgctg
gccgggcactcggagcggcgcgaataccaccacgaggacgacgcggtcgtcaacgcgaaa
gtcaaagcggccttcgccagcggcatcacgcccatcctgtgcctgggtgaagggttggag
gtccgcaaggcgggacgccacgtcgagcacaccctcgcccagttggaaggcgcgctcaag
ggcgtgaccgaggagcaagtccgcaccctggtcgtggcctacgagccggtgtgggcgatc
ggtaccggcgaagtcgccacgcccgaggacgcccaggaggtgtgcgcggcgctgcgcaag
cggattggtgaactgtactcccctgaggccgcacagcagacccgcatcctctacggcggg
tcggtgaagagcggcaacgtcgcagcgatcatggcgcaagcagacgttgacggcgcgctg
gtcggcggtgcgagcctggacgctgacgagttcgtcaagctgatccgcgccgcggtccag
ggctga

DBGET integrated database retrieval system