KEGG   Thermobifida fusca: Tfu_2176Help
Entry
Tfu_2176          CDS       T00265                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tfu  Thermobifida fusca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tfu_2176
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tfu_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
2552833..2555475
Genome map
AA seq 880 aa AA seqDB search
MSVTEPPPRRRGRHSRARRFLTSLGATAALTAGMLGVPLATGTAHAEPAFNYAEALQKSM
FFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFPMAFTATMLA
WGAIESPEGYIRSGQMPYLKDNLRWVNDYFIKAHPSPNVLYVQVGDGDADHKWWGPAEVM
PMERPSFKVDPSCPGSDVAAETAAAMAASSIVFADDDPAYAATLVQHAKQLYTFADTYRG
VYSDCVPAGAFYNSWSGYQDELVWGAYWLYKATGDDSYLAKAEYEYDFLSTEQQTDLRSY
RWTIAWDDKSYGTYVLLAKETGKQKYIDDANRWLDYWTVGVNGQRVPYSPGGMAVLDTWG
ALRYAANTAFVALVYAKVIDDPVRKQRYHDFAVRQINYALGDNPRNSSYVVGFGNNPPRN
PHHRTAHGSWTDSIASPAENRHVLYGALVGGPGSPNDAYTDDRQDYVANEVATDYNAGFS
SALAMLVEEYGGTPLADFPPTEEPDGPEIFVEAQINTPGTTFTEIKAMIRNQSGWPARML
DKGTFRYWFTLDEGVDPADITVSSAYNQCATPEDVHHVSGDLYYVEIDCTGEKIFPGGQS
EHRREVQFRIAGGPGWDPSNDWSFQGIGNELAPAPYIVLYDDGVPVWGTAPEEGEEPGGG
EGPGGGEEPGEDVTPPSAPGSPAVRDVTSTSAVLTWSASSDTGGSGVAGYDVFLRAGTGQ
EQKVGSTTRTSFTLTGLEPDTTYIAAVVARDNAGNVSQRSTVSFTTLAENGGGPDASCTV
GYSTNDWDSGFTASIRITYHGTAPLSSWELSFTFPAGQQVTHGWNATWRQDGAAVTATPM
SWNSSLAPGATVEVGFNGSWSGSNTPPTDFTLNGEPCALA
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcactgaacctcctccccgccgacgcggccgtcacagccgggcgcgccgcttc
ctcacttccctgggagctaccgcggccctcaccgcgggcatgctgggcgtccccttggcc
acgggaaccgcccacgccgaaccggcgttcaactacgccgaagccctccagaagtcgatg
ttcttctacgaggcccaacgctccgggaaactcccggagaacaaccgggtctcctggcgc
ggcgactccgggctcaacgacggcgcggacgtgggactcgacctcaccggcggctggtac
gacgccggcgaccacgtgaaattcggcttccccatggccttcaccgcgaccatgctcgcc
tggggcgccatcgaaagcccggaaggctacatccgctccggccagatgccctacctcaag
gacaacctgcgctgggtcaacgactacttcatcaaagcccacccctcgcccaacgtgctg
tacgtgcaggtcggcgacggcgacgccgaccacaagtggtggggtccggccgaagtcatg
ccgatggagcggcccagcttcaaagtggacccctcctgcccgggcagcgacgtcgcagcc
gaaaccgccgcggccatggccgcgtcctccatcgtgttcgccgacgacgaccctgcgtac
gcggccaccctcgtgcagcacgccaagcagctctacacgttcgccgacacctaccgcggc
gtgtactccgactgcgtgcccgccggagcgttctacaactcctggtcgggctaccaggac
gagctcgtctggggcgcctactggctgtacaaggccaccggggacgactcctacttggcg
aaggccgagtacgagtacgacttcctctccaccgagcagcagaccgacctccgcagctac
cggtggaccatcgcctgggacgacaagtcctacggcacctacgtgctgctcgccaaggaa
accggcaagcaaaaatacatcgacgacgccaaccggtggctcgactactggacggtcggc
gtcaacggccagcgcgtgccctactcccccggcgggatggctgtgctcgacacctgggga
gccctgcgctacgccgctaacaccgcgttcgtcgccctcgtctacgccaaggtgatcgac
gaccccgtccgcaagcagcggtaccacgacttcgcggtgcggcagatcaactacgcgctc
ggcgacaacccgcggaactccagctacgtggtgggcttcggcaacaacccgccgcgcaac
ccccaccaccgcaccgcgcacgggtcgtggaccgacagcatcgcctcgcccgcggagaac
cggcacgtcctctacggcgccctcgtcggcggtcccggctccccgaacgacgcctacacc
gacgaccggcaggactacgtcgccaacgaagtcgccaccgactacaacgccggattctcc
agcgcgctggccatgctggtcgaagagtacggcggcaccccgctggcggacttcccgccc
accgaggagcccgacggaccggagatcttcgtggaagcccagatcaacacgccgggcacc
acgttcaccgagatcaaagccatgatccgcaaccagtcgggctggccggcccggatgctg
gacaagggcaccttccggtactggttcaccctcgatgaaggcgtggaccccgcggacatc
acggtgagctccgcctacaaccagtgcgccaccccggaggacgtccaccacgtctccggc
gacctgtactacgtggagatcgactgcaccggggagaagatcttccccggcggccagtcg
gagcaccgccgcgaagtccagttccgcatcgccggcggccccggatgggacccctccaac
gactggtccttccaaggcatcggcaacgaactcgcccccgccccgtacatcgtgctctac
gacgacggtgtaccggtgtggggcaccgcccccgaggaaggggaagagcccggcggcgga
gaaggaccgggaggcggcgaagaacccggcgaggacgtgaccccgccgagcgcgcccggc
tcccccgcggtccgggacgtcacctccaccagcgccgtgctcacctggtccgcgtccagc
gacaccggcggcagcggcgtagccgggtacgacgtcttcctccgcgccggcacaggccag
gagcagaaggtgggatccaccacccggaccagcttcaccttgaccggtctagaacccgac
accacctacatcgcggctgtcgtggcccgggacaacgcgggcaacgtctcccagcggagt
accgtctccttcaccacgctggccgagaacggcggcgggcctgacgcctcctgcacggtg
ggctacagcaccaacgactgggactccggattcaccgcttcgatccggatcacctaccac
ggcacggccccgctctccagctgggagctctccttcaccttccccgctggccagcaggtc
acccacgggtggaacgccacgtggcgccaggacggggccgccgtgaccgccacccccatg
tcctggaacagctccctggcgcctggagccaccgtcgaggtcggcttcaacggctcctgg
agcggcagcaacacacctcccaccgatttcaccctcaacggcgagccctgcgccctcgcc
taa

DBGET integrated database retrieval system