KEGG   Thermobifida fusca: Tfu_2205Help
Entry
Tfu_2205          CDS       T00265                                 

Definition
glycoside hydrolase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tfu  Thermobifida fusca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tfu_2205
Enzymes [BR:tfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tfu_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2592203..2594311)
Genome map
AA seq 702 aa AA seqDB search
MSDAALVRLAEAHGVATSYVNWQGTRIPVSVDTLRHVLTALGVDVSDPEAALRAHQEAQA
AHPLPPAVVTRAGHTPRLPLPDEARTWVELADGGYTDVGPTLPLGLHRLHVDNRGNHQQR
PLLVAPARLSRSVPRRMWGLMTQLYSVRSHVSWAMGDLHNLAELATWSARDLGASFILVN
PLHATEPLPPVTDSPYLPVSRHYASPLYIRIEDIPEYARLNSIQRETIQRFARPLRERGR
TADLLDRNAVWQAKRAALEIIYGVSRSEEREQAFRDYLDREGEALERYATWCAIAEEHGP
DYRRWPEPLRDPTAEEVRVETRRRWRRVDFYRWTQWILDSQLTHAQTAARNAGMDVGIVH
DLAVGAQSGGADAWIHREVLVPGIHVGAPPDEFNQQGQDWGQAPWHPVRLAEQGYLPFLD
QLRQVGRHAGGIRVDHVMGLFRLWWIPEGADPAEGTYVRYDHEGMVGALLLAAHEANALV
IGEDLGTVEPWVRDYLSERGVFGTSVLWFERDEHGAPRRPETWRTDCLATVATHDLPPIT
SYVTAEHVALRSHLGLLTRPVEEERAEAEAQVAAWCALLTELGLLAEGTDPVAQPAAVVT
ALHSYLARTPAVLVGVSLADVVGDHRMQNQPGTSSGYPNWRIPLTNSEGEPVLLEDLITN
PQWAAAVRAALGELTQLSPGSGTARAAPPLPRPSRSFLCPQW
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatgctgcactggtccggctagccgaggcgcacggcgtcgcaaccagctatgtg
aactggcaggggacccggatccccgtttccgtggacacgctgcgccacgtgctcaccgcc
ctgggcgtggacgtcagcgaccctgaggccgcgctgcgggcgcaccaggaagcccaggcc
gctcacccgcttcccccggccgtcgtcacccgagccgggcacaccccgcggctccccctg
cccgacgaggcccggacctgggtggaactcgccgacggcgggtacaccgatgtcggtccc
accctcccgctcggcctccaccggttgcacgtggacaaccgcggcaaccaccagcagcgt
cccctcctggtcgcacccgctcggctgtcccgctccgtgccccgccgcatgtgggggctg
atgacccagctctactcggtccgctcccacgtctcgtgggctatgggagacctccacaac
ctcgccgagctggccacctggtccgcccgcgacctgggggcgtccttcatcctcgtcaac
cccctgcacgccaccgaaccgctgccgcccgtcaccgactccccgtatctgccggtcagc
cgccactacgccagcccgctctacatccgtattgaagacatccccgagtacgcgcggctc
aactcgatccagcgggaaaccatccagcggttcgcccggccgcttcgcgagcgggggcgc
accgccgacctgctggaccgtaacgcggtctggcaagccaaacgggccgccctggaaatc
atctacggggtcagccgctcagaggagcgggagcaggcgttccgcgactacctggaccgc
gaaggcgaagccctggaacgctacgccacgtggtgcgcgatagccgaagagcacggaccg
gactaccgccgctggccggagccgctgcgcgaccccaccgccgaagaggtccgcgtcgaa
acgcggcgccgctggcgtcgcgtggacttctaccgctggacccagtggattctcgacagc
caactcacccacgcccagaccgcggcacgcaacgccggaatggacgtgggaatcgtgcac
gatcttgcggtcggggcgcagagcggcggcgcagacgcctggatccaccgcgaagtgctc
gtccccgggatccacgttggcgcacccccggacgagttcaaccagcagggccaggactgg
gggcaagcgccctggcatccggtgcgcctcgccgaacagggctaccttcccttcctcgac
cagcttcggcaggtagggcggcacgctggcggcatccgggtcgaccacgtcatgggacta
ttccggctgtggtggatcccggagggggccgaccccgccgaagggacctacgtgcgctac
gaccacgagggcatggtgggcgcgctgctcctggccgcccacgaagcaaacgcgctcgtc
atcggggaagacctggggacagtcgaaccgtgggtccgcgactacctgtccgaacgcgga
gtgttcggcacatccgtgctgtggtttgaacgcgacgagcatggcgccccgcgccgcccg
gaaacctggcggaccgactgcctggccacggtcgccacccacgaccttcccccgatcacc
tcctatgtcacggccgagcacgtggctttgcgttcccacctgggcctgctcacccgcccg
gtggaagaagagcgcgccgaagccgaagcccaggtcgccgcctggtgcgcgctgctcacc
gaactcgggctgctcgcggagggaaccgaccccgtggctcagcccgccgctgtggtcacc
gcgctgcacagctacctggcgcgcacccctgccgtcctggtgggcgtgtccctggccgat
gtggtcggcgaccaccgcatgcagaaccagccgggaaccagcagcggataccccaactgg
cggatcccgctcaccaacagtgaaggggagccggtcctcctcgaagacctgatcaccaat
ccgcagtgggctgcggcagtgcgtgccgcactcggggagctcacccaactgtccccgggc
agcggcacggcacgggccgcgcccccactgccccgcccatcccggtcgttcctctgcccg
cagtggtga

DBGET integrated database retrieval system