KEGG   Thermobifida fusca: Tfu_2332Help
Entry
Tfu_2332          CDS       T00265                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
tfu  Thermobifida fusca
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tfu_2332
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Tfu_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2745520..2747388
Genome map
AA seq 622 aa AA seqDB search
MTHEQHSTLPTGDDDRFDYDVIVVGSGFGGSVSALRLTEKGYRVGVLEAGRRFTPETLPK
NSWDLRNFLWAPRLGFFGIQRIHLLRDVMILAGAGVGGGSLNYANTLYEPLDDFYNDPQW
RDITDWREELAPFYDQAKRMLGVRTNPTVTPADVHLRHAAEAMGVGSTFHLAPVGVFFGD
GKDGAATQPVSPGEACRDPYFGGAGPTRRACLECGECMTGCRHGAKNMLTENYLYFAERH
GAVIHPMTTVVAIRERPASLGGGYAVDTVATGAFRTRRATRTFTARYIVLAAGTYGTQRL
LHAMRDSGLLPRISPKLGTLTRTNSEALVGAMTKAIRPPQDFTQGVAITSSMHPDAHTHI
EPVRYGKGSNAMGLLTTMQVPGGGRIPRWLRFLGVIAAHPYLFMRSLSVRRWSQRTIIGL
VMQSLDNSLTTYTRRGLFGRRVLTSRQGHGAPNPTWIPVAQQFAAQIAKQIDGYPGSCVS
EIFDIPLTAHFLGGCPIGASPEEGVIDPYHRLYGHPGIHVVDGSAVTANLGVNPSLTITA
QAERAMAMWPNKGEPDPRPAPGSPYQRVEPVYPVRPAVPAGAYAELRFTRRIALPLDVSR
PQRTPGGTGTDTVRRTDAPPAP
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgagcagcactccacccttcccaccggggacgacgaccggttcgactacgac
gtcatcgtcgtcggttcaggattcggcggctcagtcagcgcgctgcgccttaccgagaag
ggctaccgggtcggagtcctcgaggccggacgccgcttcacccccgagaccctgccgaag
aactcctgggacctgcgcaacttcctctgggcgcctcggctggggttcttcggcatccag
cgcatccacctgctgcgcgacgtcatgatcctggctggggccggggtcggcggcggctcc
ctcaactacgccaacaccctctacgaaccactggacgacttctacaacgacccgcagtgg
cgggacatcaccgactggcgagaagaactcgcccccttctacgaccaagccaaacgcatg
ctcggggtgcggaccaaccccaccgtcacccctgcggacgtccacctgcgccacgccgcc
gaggccatgggggtcggctccaccttccacctcgccccggtcggcgtcttctttggcgac
ggcaaggacggggcggccacccaaccggtctcccccggcgaagcctgccgcgacccctac
ttcgggggtgccggcccgacccggcgcgcctgcctggagtgcggggagtgcatgaccggt
tgtcggcacggcgcaaaaaacatgctcaccgagaactacctgtacttcgcggagcgccat
ggcgccgtcatccaccccatgaccaccgtggtagcgatccgcgaacgccctgcctccctc
ggcggcggctatgcggtcgacaccgtagccaccggtgctttccgcacccggcgcgccacc
cgcacgttcaccgcccgctacatcgtgctcgctgctggcacctacggcacgcagcgcctc
ctgcacgccatgcgcgactccgggctcctgccccgcatctcccccaagctcggcacgctc
acccgcaccaattccgaagccctcgtcggcgcgatgaccaaggcgatacgcccgccccag
gacttcacgcagggcgtggcgatcacctcctccatgcaccctgacgcgcacacgcacatc
gagccggtccgctacggcaaaggctccaacgcgatggggctgctcaccaccatgcaagtc
cccggcgggggacgcatcccccgctggctgcgcttcctcggcgtaatcgccgcccacccc
tacctcttcatgcgcagcctgtccgtgcgccgctggtcgcagcggaccatcatcggcctg
gtcatgcagtccctggacaactcgctgaccacctacacccggcggggactgttcggccgg
cgggtgctgacctctcggcagggccacggcgctcccaaccccacgtggatcccggtggcc
cagcagttcgccgcccagatcgccaaacagatcgacggctacccgggcagttgcgtcagc
gaaatcttcgacatcccgttgaccgcgcacttcctgggcggctgcccgatcggcgcctcc
cccgaggaaggtgtaatcgacccctaccaccggctctacggccatcccggcatccacgtg
gtggacgggtcagccgtcaccgccaatctgggcgtcaacccgtcgttgacgatcaccgcc
caagcggaacgcgccatggcgatgtggcccaacaagggggagcctgacccgcggcccgct
ccgggctccccctaccagcgggtggagccggtctacccggtccgtccagcagtgccggca
ggcgcctacgcggagctgcggttcacccgccgcattgcgctccccttggacgtgagccga
ccgcagcgcaccccgggaggcaccggcacggacacggtcaggcggaccgatgctccgccc
gctccttga

DBGET integrated database retrieval system