KEGG   Thermobifida fusca: Tfu_2374Help
Entry
Tfu_2374          CDS       T00265                                 

Definition
pyrazinamidase / nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tfu  Thermobifida fusca
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:tfu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2795360..2795938
Genome map
AA seq 192 aa AA seqDB search
MAKALIVVDVQNDFCEGGSLAVSGGAGVATAISDYLAKQGSQYAHIVATRDRHIDPGDHF
SDNPDFVDSWPPHCVAGTPGAEFHPNLVTGPIEAVFDKGAYEAAYSGFEGKTADGVSLEE
WLRQHGITEVDVVGIATDHCVRATALDAVRAGFQARVLLGMTAGVSRATTEKALRELAEA
DVALEGEPVVAA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagcactgatcgtcgttgacgtacagaacgacttctgtgaaggcggcagtctg
gccgtgtccggtggtgccggcgtggccacggctatctccgactacctggccaagcagggc
agccagtacgcccacatcgtggctacccgggaccgccacatcgacccgggggaccacttc
tccgacaaccccgactttgtggactcgtggccgccgcactgcgtggcgggcaccccgggg
gcggagttccaccccaacctggtcaccggaccgatcgaggcggtgttcgacaaaggcgcc
tacgaggccgcgtacagcggtttcgaggggaagaccgcggatggcgtgtctttggaggag
tggctgcggcagcacgggatcaccgaagtggacgtggtgggtattgccaccgaccactgt
gtgcgggctactgccttggacgcggtccgggccgggttccaggcgcgagtgctgctggga
atgaccgcaggggtgtcccgcgcaaccacggagaaggctctgcgggagctggctgaggca
gacgtggccctggaaggtgagccggtggtggccgcctaa

DBGET integrated database retrieval system