KEGG   Thermobifida fusca: Tfu_2423Help
Entry
Tfu_2423          CDS       T00265                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tfu  Thermobifida fusca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tfu_2423
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_2423
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tfu_2423
Enzymes [BR:tfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tfu_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2843904..2844968)
Genome map
AA seq 354 aa AA seqDB search
MSMARAWRGIVEEYRDRLPVTANTPVVTLLEGGTPLVPATRVSELTGCEVYLKVEGLNPT
GSFKDRGMTMAISKAAEEGAKAVICASTGNTSASAAAYAVRAGMTCAVLVPRGKIAMGKL
AQALVHGARLLQVDGNFDDCLELARQLSTDYPVALVNSVNPFRLQGQKTASFEIVDALGD
APDVHCLPVGNAGNITAYWMGYQEYHSDGLATRLPRMFGFQASGASPIVDGAPVTQPRTI
ATAIRIGNPASWRFAEKARDESGGRIDAVTDRQILAAYRLLAGQEGVFVELASAASVAGL
LQAVEAGQIERGSRVVCTVTGNGLKDPDWALAGASSATTIPVDAQAAAAALGLA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggcacgggcgtggcgaggaatcgtcgaggaatatcgcgatcgccttcccgtc
acggcgaacaccccggtcgtcaccctgcttgaggggggtacaccgctggttcccgccacg
cgggtttcggaactgaccggatgcgaggtctacctcaaggttgaagggctcaatcccacg
ggctccttcaaagaccgcgggatgaccatggccatctccaaagccgctgaggaaggagcc
aaagcggtcatctgcgcgtccacggggaacaccagcgccagcgccgccgcctacgcggta
cgcgccgggatgacctgcgcggtcctcgtgccccggggcaagatcgccatgggcaaactg
gcgcaagccctcgtccacggcgcccgcctgctccaagtcgacggcaacttcgacgactgt
ctggaactggcccgccagctctccaccgactacccggtggcgctggtcaactcggtcaac
ccgttccgcctccagggccagaagaccgcctcgttcgagatcgtggacgccctcggcgac
gctcccgacgtccactgcctgccggtgggcaacgcgggcaacatcaccgcctactggatg
ggctaccaggagtaccactcagacggactggccacccgcctgccgcgcatgttcggcttc
caagccagcggggcctcaccgatcgtcgatggcgcaccggtgacccagccgcgtactatt
gctactgccatccggatcggcaaccctgcttcctggcggtttgcggaaaaggcccgcgac
gagtccggcggtcgcatcgatgcggtcaccgaccggcagattctcgccgcctaccggctg
cttgccggccaggaaggggttttcgtggaactggcctccgcggccagtgtggcgggccta
ctgcaggcagtggaagccgggcagatcgagcggggcagccgcgtcgtctgcacggtcacc
ggcaacggcctcaaagaccccgactgggctctggccggcgcctcctctgccaccacgatt
cctgtcgatgcccaggccgctgcggcggcgctcggcctggcctag

DBGET integrated database retrieval system