KEGG   Thermobifida fusca: Tfu_2759Help
Entry
Tfu_2759          CDS       T00265                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tfu  Thermobifida fusca
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Tfu_2759
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tfu_2759
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Tfu_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3236321..3236953)
Genome map
AA seq 210 aa AA seqDB search
MTLPNSLCRIACATILGPRGSEHGTVRHAARQDSPVGSSDGQGAEARLRDMKIYQSELRT
LEGEPFRLPQTQLLLIVNVASKCGLTPQYSGLERLQEAYAYRGFSVIGVPCNQFGGQEPG
DAQEIRLFCATTYGISFPILEKMEVNGPNRHPLYVELTKARDSQGLAGDVQWNFEKFLVA
PGGRVLYRFRPQVEPEDPEIIRAIEENLPN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccctaactctctgtgccggattgcctgcgccacgatcctaggcccgcggggg
agtgagcacgggacggttcggcatgcggcgcggcaggattcgcctgtggggtcttcggac
gggcagggggctgaggctaggctccgggacatgaagatctaccagagcgagttgcggacg
ttggagggcgagccgttccggctgccgcagacgcaactgctgctgatcgtcaacgtcgct
tccaagtgtggcctgaccccccagtacagcggcctggagaggctccaggaagcgtacgcc
taccgggggttctcggtgatcggggtgccgtgcaaccagttcggcggccaggagccgggg
gatgcccaggagatccggttgttctgcgccaccacgtacggcatcagtttccccatcttg
gagaagatggaggtcaacggccccaaccggcatccgttgtacgtcgagttgaccaaggct
cgggactcccaggggttggcgggggatgtccagtggaacttcgaaaagttcctggtcgcc
cccggcggcagggtgctgtaccgcttccggccccaggtggagcctgaagaccccgagatc
atcagggcgatcgaagagaacctgccgaactga

DBGET integrated database retrieval system