KEGG   Thermobifida fusca: Tfu_2771Help
Entry
Tfu_2771          CDS       T00265                                 

Definition
dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tfu  Thermobifida fusca
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tfu_2771
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_2771
  Lipid metabolism
   00071 Fatty acid degradation
    Tfu_2771
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tfu_2771
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tfu_2771
   00626 Naphthalene degradation
    Tfu_2771
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tfu_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3251047..3252093
Genome map
AA seq 348 aa AA seqDB search
MHAVQYREVGQPPRVVDVDVPTPGPGQILLRVTAAGICHSDLTVMHWDAKTLPYQLPLTL
GHEGAGVVEAVGENVNAVSVGDSVVVYGPWGCGTCHACSQGRENYCPRAARLGIMPPGLG
RPGALAEYLLVDSERHVVPIGDLDPVKTVPLTDAGLTPYHAIKRSMSKLEPGSVAVVIGA
GGLGHVGIQLLRLMSAATVVALDIREESRELALRSGAHHALPSDSKAVGLVRELTDGAGA
DVVFDFVGAQVTLDLAAQMAGLDSHINIIGIGGGSLPVSFDSLPYGTRVSTSYWGTRSEL
IELVELAKQGAIDVHVERYELEEGPEVYKRMEAGKIQGRAVLVPAQRS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccgtccaataccgtgaggtcggccagccgccccgcgtcgtcgacgttgacgtg
cccactcccggccccggccagatcctgctgcgcgtcaccgccgcgggaatctgccactcc
gacctcacagtcatgcactgggacgccaaaaccctcccctaccagttgccgctcaccctg
ggccacgagggcgctggcgtcgtcgaagccgtgggggagaacgtgaacgccgtctccgtc
ggcgactcggttgtcgtctacggaccgtgggggtgcggcacctgccacgcctgctcgcaa
ggccgggagaactactgtccgcgcgccgcgcgcctcggcatcatgcccccgggactgggc
cgtcccggagcactagcggaatacctgctcgtcgactcggagcggcacgtggtgccgatc
ggggacctcgacccggtgaaaaccgtcccgctcacggacgctggactcaccccgtaccac
gcgatcaaacgctccatgtccaagctggaaccgggcagtgtcgcggtggtcatcggcgca
ggcgggctggggcacgtcggcatccaactgctgcgcctcatgtccgcagccaccgtggtg
gccttggacatccgcgaggagagccgggaactggcgttgcgcagcggagcgcaccacgcg
ctgccgtccgactccaaagccgtgggcctggtgcgggagctgaccgacggcgcaggcgcc
gacgtggtgttcgacttcgtgggggcacaggtcaccctcgaccttgccgcgcagatggca
ggcttggactcccacatcaacatcatcggtatcggcggtgggtcgctgccggtgtcgttc
gactcgctcccctacggcaccagggtgagcaccagctactggggcacccgctccgagctg
atcgaactcgtcgaactcgccaaacagggcgcgatcgacgtgcacgtggaacgctacgag
cttgaggaaggccccgaggtgtacaagcggatggaggccgggaagatccagggtcgcgcg
gtgttggtgcccgcccagaggtcgtga

DBGET integrated database retrieval system