KEGG   Thermobifida fusca: Tfu_2808Help
Entry
Tfu_2808          CDS       T00265                                 

Definition
(GenBank) putative acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00010  Glycolysis / Gluconeogenesis
tfu00620  Pyruvate metabolism
tfu00640  Propanoate metabolism
tfu00680  Methane metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_2808
   00620 Pyruvate metabolism
    Tfu_2808
   00640 Propanoate metabolism
    Tfu_2808
  Energy metabolism
   00680 Methane metabolism
    Tfu_2808
Enzymes [BR:tfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tfu_2808
Lipid biosynthesis proteins [BR:tfu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tfu_2808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAZ56841
JGI: Tfu2808
UniProt: Q47L31
Position
complement(3296407..3298152)
Genome map
AA seq 581 aa AA seqDB search
MDSTMNRPRGGDVTDGSATENYRRARDTLLGLSGDHRTAVETFRWPDLGPRFNWAIDWFE
VYARDNDTTALWIVEEDGSEAKYSFAEMVHRSDQVAAWLAEQGVRRGDRVMVMLGNQVEL
WETMLAVMKLGAVILPATTALGPADLADRIERGGAKHVVTSAANTAKFAEVPGDYGRIVV
DGDVPGWADYRAAATIAEPKIAHPETAPDDPLLLYFTSGTTSRPKLVQHTQASYPLGHLT
TMYWIGVRPGDIHLNISSPGWAKHAWSCFFTPWIAEATVFVYNYSRFDAAALLAHIRRAG
VTTFCAPPTVWRMLINADLSGGPGALREIVAAGEPLNPEVIDQVRRAWGLTLRDGFGQTE
MTAVVGNTPGSPVKPGSMGRPLPGCPVVLIDPRSGQPAEEGEICLDLSARPVMLMRGYQD
DPERNAEAMEGGWYHTGDIARRDADGYITYIGRTDDVFKASDYKISPFELESVLIEHPAV
AEVAVVPAPDPVRLAVPKAYVALAPGYEPTRETALSILRYARENLAPFQRVRRLEFAELP
KTISGKIRRVELRQQEQERAEGTGQASQEWRDDEFPELRRS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtggacagcaccatgaaccgacctcgagggggagacgtgaccgacggttccgcaaccgag
aactatcgtcgcgcccgcgacaccctgctgggactgtccggagaccaccgcaccgcggtg
gagacgttccgctggcctgacctgggaccccggttcaactgggcgatcgactggttcgaa
gtctacgcgcgggacaacgacaccacggcgctgtggatcgtcgaagaggacggcagcgaa
gcgaagtacagcttcgctgagatggtccaccgctccgaccaggtagccgcttggctggca
gagcagggggtgcggcgcggcgaccgggtgatggtcatgctcggcaaccaggtggaactg
tgggagacgatgctcgccgtgatgaagctcggcgcggtgatcctcccggccaccaccgcc
ctgggcccggccgacctggctgaccggatcgagcgcggcggcgccaaacatgtggtgacc
tctgccgcgaacaccgcgaagtttgccgaagtgcccggcgactacggcaggatcgtcgtg
gacggcgacgtcccgggctgggccgactaccgcgctgccgccacgatcgctgaaccgaag
atcgcacacccggagaccgccccggacgacccgctgctgctgtacttcacttccggtact
acgagccgccccaaactcgtccagcacacccaagcctcgtatcccctcggccacttgacg
accatgtactggatcggggtgcgccccggcgacatccacctcaacatcagctcgccgggc
tgggcgaaacacgcgtggagctgcttcttcactccctggatcgccgaagccaccgtgttc
gtctacaactactcccggttcgacgctgcggcgctgctcgcgcacatccgccgcgccggg
gtcaccacgttctgcgcaccgccgaccgtgtggcggatgctcatcaacgcggacctctcc
ggcggccccggcgcgctgcgggagatcgtcgccgcaggtgagcccctcaaccccgaggtg
atcgaccaagtgcgccgagcctggggcctgaccttgcgcgacggattcgggcagaccgag
atgaccgctgtcgtggggaacaccccgggctccccggtcaaacccgggtcgatgggccgc
ccgctccccggctgcccggtcgtgctgatcgatccccgcagcggacagcccgccgaggaa
ggcgagatctgcctcgacctgtcggcccgtccggtgatgctcatgcgcggctaccaggac
gacccggagcgcaacgcggaggcgatggaaggcggctggtaccacacgggcgacatcgcc
cggagggacgctgacgggtacatcacctacattgggcgcaccgacgacgtgttcaaagcc
tccgactacaagatcagcccgttcgagctggagagcgtgctcatcgagcatccagcggtg
gcggaggtcgcggtggtgcccgcccctgacccggtgcggctggcagtgcccaaagcgtac
gtggcgctggcccccggatacgagccgacacgggagacagcgctgtcgatcctgcggtat
gcccgggagaatctcgcaccttttcagcgggtgcggcggctggagtttgccgagttgccg
aaaacgatctcgggcaagatccgccgagtggaattgcggcagcaggagcaggaacgtgct
gagggcacgggacaggcgagtcaggagtggcgcgacgacgagtttccggaactgcgccgt
tcgtaa

DBGET integrated database retrieval system