KEGG   Thermobifida fusca: Tfu_2893Help
Entry
Tfu_2893          CDS       T00265                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
tfu  Thermobifida fusca
Pathway
tfu00790  Folate biosynthesis
tfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tfu_2893
Enzymes [BR:tfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Tfu_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AAZ56926
JGI: Tfu2893
UniProt: Q47KU6
Position
complement(3407476..3408384)
Genome map
AA seq 302 aa AA seqDB search
MATTKELPGLPVEERCLVMGVVNVTPDSFSDGGRWFDAGRAIEHGLRMVGEGADIVDVGG
ESTQPGAQRVPADEELRRVLPVVTELARQGVVVSVDTMRAEVAAAAVDAGAVLVNDVSGG
MADPAMARLVASTGVSYVLMHWRGHSHDMQKRAVYTDVVQEVYDELEQRMTAVVDEGVDP
GQIIIDPGLGFAKSPEKGHNWALLAHLDRFAQLGRPILIGGSRKRFLGRLLSDADGNPRS
FTECDDATVAVTALAAFHGAWAVRVHEVRPNADAVRVAQAWRSGGTALIDGRAEIPRVRG
GQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacaaaggaacttcccggtcttccggtcgaagaacgctgcctggtgatgggg
gtcgtcaacgtcacccctgactcgttctccgacggtggccgatggttcgacgctggtcgg
gcgatcgagcacggtctgcggatggtcggggagggcgcggacatcgtcgatgtgggcggc
gagtccacacagcccggtgcgcagcgggtccccgcggacgaggagctgcgccgggtgctg
ccggtggtcaccgaactggcccggcagggagtcgtcgtcagcgttgacaccatgcgcgcg
gaggtcgccgcggcggccgtggacgcgggcgcggtgctcgtcaacgacgtcagcgggggg
atggcggacccggcgatggcccgcctcgtagcgtccaccggtgtctcctatgtattgatg
cactggcgtgggcatagtcatgacatgcagaaacgcgccgtgtacaccgacgtcgtgcaa
gaggtctacgacgagctggagcagcgcatgacggccgtggttgatgagggggtcgacccg
ggccagatcatcatcgaccctgggctggggttcgcgaaaagcccggagaaggggcacaac
tgggcgctgttggcgcacctggaccgcttcgcccagctgggccgcccgatcctcatcggc
ggatcccgcaaacgcttcttagggcggctgctcagcgacgcggacggcaacccgcgcagt
ttcacggagtgcgacgacgccacggtcgccgtgaccgcgttggctgcgttccacggcgcc
tgggcggtccgcgtccacgaggtgcgccccaacgcggacgcggtgcgcgtcgcccaagcg
tggcggagcggcgggaccgccctcatcgacgggcgcgccgagatcccccgggtgcggggc
ggccagtga

DBGET integrated database retrieval system