KEGG   Thermobifida fusca: Tfu_2894Help
Entry
Tfu_2894          CDS       T00265                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tfu  Thermobifida fusca
Pathway
tfu00790  Folate biosynthesis
tfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tfu_2894
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tfu_2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AAZ56927
JGI: Tfu2894
UniProt: Q47KU5
Position
complement(3408499..3409122)
Genome map
AA seq 207 aa AA seqDB search
MTEYEYRVGDTDAGLAPAGIDQPRIEKAVREILLAIGEDPDRDGLVETPARVARAFAEQF
AGLSQRPEDVLTTVFEANHEEMVLVKDIELYSTCEHHLVPFYGAAHVGYIPNTDGRITGL
SKLARLVDIYARRPQVQERLTSQVADALMERLEPRGVIVVVEAEHLCMTMRGVRKPGAKT
VTSAVRGAFRESYKTRAEAMDLILGRR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagtacgaataccgggttggtgataccgacgcgggtctcgcccccgcggggatc
gaccagccgcggatcgagaaagcggtgcgggaaatcctgctggctatcggcgaggacccg
gatcgggacggtctcgtggagaccccggcccgggtcgcacgggccttcgcggagcagttc
gctgggctcagccagcgccccgaggacgtgctgaccacggtgttcgaggccaaccacgaa
gagatggtgctggtcaaggacatcgagttgtactccacgtgcgagcaccaccttgtcccc
ttctacggggctgcgcacgtggggtacatccccaacacggacggccggatcaccggactg
tccaaactggcccgtctcgtcgacatctacgcccgccgcccccaagtgcaggagcggttg
acgtcgcaggtcgcagacgcgttgatggagcggttggagccgcgcggcgtcatcgtggtc
gtcgaagccgagcacctgtgcatgaccatgcgcggtgtgcggaaaccgggggcgaaaacc
gtgacgtccgcggtgcgcggcgcgttccgggagagctacaagacccgcgccgaggcgatg
gacctcatcctgggacgccggtga

DBGET integrated database retrieval system