KEGG   Thermobifida fusca: Tfu_3016Help
Entry
Tfu_3016          CDS       T00265                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tfu  Thermobifida fusca
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tfu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tfu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3531400..3532695
Genome map
AA seq 431 aa AA seqDB search
MGQEVRYRVRGGHALHGTAFIQGAKNAVLPMIGAALLASKGRTVLRNVPVIEDVRRALEL
AEYVGAKVEFHEAERTIVIDATGLNDPNRAVLPASIASRFRGSVLFIPALMHRMGRARIE
GVGGCNLGSRNLDFHYRGFARLGAEVTEDPERKHINVKADNLKGGRLYLDTPSHTGTENL
IMAAALTPGTTVIEHAALEPEVLDVIEFLGSMGAKISGGGTGFIKVEGVSELTAVEHTVM
PDRIDTGVFAMMTAATGGDVSLVGANLDHLGVARWKLEQMGVQFTQQGAVLRVRRDPNVP
LRPINAVTSPFPGFATDLQPPLMALATLAEGESYIREAIFDGRFALADELNKMGAKIEVE
GNRAIVHGPSELHGTKVTAHDLRCGAGAIMAGLVAKGETIVSPAYQVDRGHSHFATRLSA
LGADVVREEVS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggccaggaggttcgctaccgcgtccgcggcggtcatgccttgcacggaaccgcgttc
atccaaggtgcgaaaaacgctgtcttgccgatgatcggagcggccctgctcgcatccaag
ggcaggaccgttctgcggaacgtccccgtgatcgaagatgtccgtcgcgctttggagctc
gccgagtacgtgggggccaaagtcgagttccacgaagcggagcggaccatcgtcattgat
gccaccgggctgaacgatcccaaccgggcggtgctgcccgcctccatcgcctcccgcttc
cgcggctccgtgctgttcatccccgcgctcatgcaccgtatgggccgcgcccggatcgag
ggggtgggcggatgcaacctcggcagccgcaaccttgacttccactaccggggttttgcg
cggctgggcgccgaggtcaccgaggacccggagcgcaagcacatcaacgtgaaggcggac
aatctcaagggcggacgcctctacctggacaccccgtcgcacacgggaaccgagaacctg
atcatggccgcggccctcaccccgggcaccacggtgatcgagcacgcggccctcgagccc
gaagtgctggacgtcatcgagttcttgggcagcatgggcgccaagatcagcggcggcggc
accgggttcatcaaggtcgaaggcgtctccgagctcaccgcggtggagcacacggtgatg
ccggaccgtatcgacacgggcgtgttcgcgatgatgacggccgcgaccggcggtgacgtg
agcctcgtcggcgcgaacctggaccacctgggcgtggcccgctggaaactggagcagatg
ggcgtccagttcacccagcagggcgctgtactgcgggtacgccgcgacccgaacgtcccg
ctgcggcctatcaacgccgtcacttcgcccttccccggtttcgccacggacctgcagcct
ccgctgatggcgttggccaccctggccgagggggagagctacatccgcgaggccatcttc
gacggccggttcgccctcgccgacgagctgaacaagatgggcgccaagatcgaggtcgag
ggtaaccgggcgatcgtgcacggtcccagcgaactgcacggcaccaaggtcaccgcccac
gacctgcgctgcggtgcaggggcgatcatggcgggcctggtcgccaaaggcgagacgatc
gtgagccccgcctaccaagtggaccgcggccattcccacttcgcgacccgcttgtcggct
ctgggcgccgatgttgtcagggaagaagtctcctag

DBGET integrated database retrieval system