KEGG   Thermobifida fusca: Tfu_3025Help
Entry
Tfu_3025          CDS       T00265                                 

Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
tfu  Thermobifida fusca
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tfu01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:tfu00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:tfu00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3541012..3542154
Genome map
AA seq 380 aa AA seqDB search
MKAVVYKEPFTVAVEEVADPRIEDPNDVIIRVTTSAICGSDLHMYEGRTGATPGMVFGHE
NMGIVEEVGSGVASIRKGDRVVLPFNVACGFCKNCLAGKTGFCLTVNPGFAGGAYGYVAM
GPYQGGQSEYLRVPFADFNCLKLPPGTEFEDDFALLADIFPTGYHATELAQVSPGETVSV
FGAGPVGLMAAYSAILRGASRVFVVDRVPSRLSLAERIGAIPIDYSKGDPVAQIKEHTNG
EGTDKGIDAVGYQATAPEGEEQPALVLNTLVDTVRPTGALGVVGLYVTEDPGAPSESAKQ
GELLFAMGKLFEKGQRMGTGQANVKAYNRQLRDLIIAGRAKPSFVVSQRIPLQRAPEAYE
KFDKREEGWTKVLLKPQQES
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcggtcgtgtacaaggagccgttcactgtcgcagtggaagaggtggccgatccg
cggatcgaggatcccaacgacgtgatcatccgcgtgaccacgtccgcgatctgcggctcc
gacctgcacatgtacgaggggcgcaccggcgccacccccggcatggtgttcggtcacgag
aacatggggatcgtcgaagaggtcggctccggggtggcgagcatccgcaaaggcgaccgg
gtggttctcccgttcaacgtggcgtgcgggttctgcaagaactgccttgcgggcaagacc
gggttctgcctcaccgtcaacccgggcttcgcgggcggcgcgtacggctacgtggcgatg
ggcccctaccaaggcggccagtccgaatacctgcgggtgccgttcgcggacttcaactgc
ctgaagctgccgccgggcaccgagttcgaagacgatttcgcgctgctggccgacatcttc
cccaccggctaccacgccacagagttggcgcaggtcagcccgggggagacggtgagcgtg
ttcggtgcggggccggtggggctcatggcggcctactccgcgatcctgcgcggcgcttcc
cgcgtattcgtggtggaccgggtgccgagcaggctgtctttggccgagcggatcggagcc
atccccatcgattactccaagggggacccggtcgcccagatcaaggagcacaccaacggc
gagggcacggacaaaggcatcgacgcggttggctaccaggcgacggccccggaaggcgaa
gagcagcccgcgctcgtcctcaacacgctggtcgacacggtccgtcccacgggcgctctc
ggggtggtgggcctgtacgtcaccgaggacccgggcgccccgtcggagagcgcgaagcag
ggcgagctgctgttcgcgatgggcaagctgttcgagaaaggccagcggatgggcaccggg
caggccaacgtcaaggcctacaaccggcagttgcgcgacctgatcatcgctgggcgggcc
aagccgagcttcgtggtttcgcagcggatcccgctccagcgggctcccgaagcctacgag
aagttcgacaagcgggaggaaggctggacgaaggtcctgctcaaaccgcagcaggagagc
tga

DBGET integrated database retrieval system