KEGG   Thermobifida fusca: Tfu_3025Help
Entry
Tfu_3025          CDS       T00265                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
tfu  Thermobifida fusca
Pathway
tfu00625  Chloroalkane and chloroalkene degradation
tfu00680  Methane metabolism
tfu01100  Metabolic pathways
tfu01120  Microbial metabolism in diverse environments
tfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Tfu_3025
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tfu_3025
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Tfu_3025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AAZ57058
JGI: Tfu3025
UniProt: Q47KG4
Position
3541012..3542154
Genome map
AA seq 380 aa AA seqDB search
MKAVVYKEPFTVAVEEVADPRIEDPNDVIIRVTTSAICGSDLHMYEGRTGATPGMVFGHE
NMGIVEEVGSGVASIRKGDRVVLPFNVACGFCKNCLAGKTGFCLTVNPGFAGGAYGYVAM
GPYQGGQSEYLRVPFADFNCLKLPPGTEFEDDFALLADIFPTGYHATELAQVSPGETVSV
FGAGPVGLMAAYSAILRGASRVFVVDRVPSRLSLAERIGAIPIDYSKGDPVAQIKEHTNG
EGTDKGIDAVGYQATAPEGEEQPALVLNTLVDTVRPTGALGVVGLYVTEDPGAPSESAKQ
GELLFAMGKLFEKGQRMGTGQANVKAYNRQLRDLIIAGRAKPSFVVSQRIPLQRAPEAYE
KFDKREEGWTKVLLKPQQES
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcggtcgtgtacaaggagccgttcactgtcgcagtggaagaggtggccgatccg
cggatcgaggatcccaacgacgtgatcatccgcgtgaccacgtccgcgatctgcggctcc
gacctgcacatgtacgaggggcgcaccggcgccacccccggcatggtgttcggtcacgag
aacatggggatcgtcgaagaggtcggctccggggtggcgagcatccgcaaaggcgaccgg
gtggttctcccgttcaacgtggcgtgcgggttctgcaagaactgccttgcgggcaagacc
gggttctgcctcaccgtcaacccgggcttcgcgggcggcgcgtacggctacgtggcgatg
ggcccctaccaaggcggccagtccgaatacctgcgggtgccgttcgcggacttcaactgc
ctgaagctgccgccgggcaccgagttcgaagacgatttcgcgctgctggccgacatcttc
cccaccggctaccacgccacagagttggcgcaggtcagcccgggggagacggtgagcgtg
ttcggtgcggggccggtggggctcatggcggcctactccgcgatcctgcgcggcgcttcc
cgcgtattcgtggtggaccgggtgccgagcaggctgtctttggccgagcggatcggagcc
atccccatcgattactccaagggggacccggtcgcccagatcaaggagcacaccaacggc
gagggcacggacaaaggcatcgacgcggttggctaccaggcgacggccccggaaggcgaa
gagcagcccgcgctcgtcctcaacacgctggtcgacacggtccgtcccacgggcgctctc
ggggtggtgggcctgtacgtcaccgaggacccgggcgccccgtcggagagcgcgaagcag
ggcgagctgctgttcgcgatgggcaagctgttcgagaaaggccagcggatgggcaccggg
caggccaacgtcaaggcctacaaccggcagttgcgcgacctgatcatcgctgggcgggcc
aagccgagcttcgtggtttcgcagcggatcccgctccagcgggctcccgaagcctacgag
aagttcgacaagcgggaggaaggctggacgaaggtcctgctcaaaccgcagcaggagagc
tga

DBGET integrated database retrieval system