KEGG   Thermococcus gammatolerans: TGAM_0089Help
Entry
TGAM_0089         CDS       T00920                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tga  Thermococcus gammatolerans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TGAM_0089 (fucA)
Enzymes [BR:tga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TGAM_0089 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83824..84393
Genome map
AA seq 189 aa AA seqDB search
MSRIAKRQLVLYSRKAHERGLTAAFGGNLSVRVGNLVFIKATGAVMDEMTDEQVAVIDLS
GNQLSDVRPSSEYRLHLAVYRVRPDVKAIAHLHPPYSIVASTLLKGELPIITPEAEIYLK
RIPIAPFRPAGTEELAEVTAEALKEADAVLMAKHGIVTVGKSLREAFYKAELVEESAKLW
YLRGNERKN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaatagcaaaacgccagctcgttctctactcgaggaaggcccacgagcgcggt
ttaactgcagctttcggcgggaacctgagcgtccgcgtcggaaatttggtattcatcaag
gcgaccggagcggttatggacgagatgaccgatgagcaggtggccgtgatagacctcagc
ggaaatcagctctcggacgttaggccctcctccgagtacaggcttcatctggccgtttac
agggtaaggcctgacgttaaggcaatagctcacctccaccctccgtactcgatagtcgcc
tcgaccctgctcaagggagaactgccgataataacgcccgaggccgagatatacctgaag
aggattccaattgcacccttccgcccggcgggcacagaggagctcgcggaggtcacggca
gaagccttgaaggaggcggacgcggtcttgatggcgaagcacggaatcgtgaccgtcgga
aaaagcctgagggaagctttttacaaggcggagctggtcgaggagagcgccaaactctgg
tacctgaggggaaatgagcggaaaaattaa

DBGET integrated database retrieval system