KEGG   Thermococcus gammatolerans: TGAM_0122Help
Entry
TGAM_0122         CDS       T00920                                 

Gene name
gor
Definition
glyceraldehyde-3-phosphate (GAP):ferredoxin oxidoreductase (gor) (EC:1.2.7.5)
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tga01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tga01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tga00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(113443..115401)
Genome map
AA seq 652 aa AA seqDB search
MRFTVLKLKLDENRVESEEFEKDDVYGVIDYGLELHESLETHSIDPYDPRNIIVMGMGPF
AGSVLPGAHRLMFFFRSPLYGTLFPSAMGGAAYAFKNVGVDFVTFEGKAEKPVVVLLYND
GESVRVELHEVELEKVIEVWRGYKGEEGVYALTQYLIDAFGSRFDFEYRIAVVGPAALNT
NYGGIFSQALRKGKRLVGSEDWAARGGSGSVLLRAHNVIGIIFGGKPRKRKFPGEDISNF
KTAKEIVEGVHKKPYNEIIAEKTVKYRYNPKLKTGGTFGGNYPAEGDFVPILNWQMPYIP
KEDRIKIHENIMKHYWEPFNEEAIKPKNWTTCGEPCPVVCKKYANGHHIEYEPREANGPL
SGVITLRASDISVPAVDAMGFDAIEFGGTAAWVLELIHRDLLKPEEVGLSGKPEFTKDAL
IERPVETSEVNAKLVAELAHRVAFGENEIAKILGLGKRKASVIFDERFKDRLKYGESFKD
YAVFTPLGEDGEITPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELAQKIIASALWEF
WYDNVGWCRFHRGWMKPVLKALFMDAYGINIDMEEHAKKQIKRLIEYARKAGYVPVFWDS
MRVIDLVAAGSEEFGNEKWAEKFRLDKVGTAKEYLSKVLDAYSEILGVEWRL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcacggttctcaaactcaagctggacgaaaacagagttgagagcgaggagttt
gagaaggacgacgtctacggcgtcatagattacggtcttgagcttcacgaaagccttgag
acccattccatcgacccctacgatcctcggaacatcattgttatgggcatggggcccttt
gcgggctcggttcttcccggagcgcatagattgatgttcttcttccgctcaccgctctac
ggcacactctttccctcggcaatgggtggtgccgcctacgccttcaagaacgtcggcgtt
gatttcgtgacctttgagggcaaggccgagaagcccgtcgtggttctcctctacaacgat
ggtgagagcgtaagggtcgagctccacgaggttgagcttgaaaaggtcatagaggtctgg
aggggctacaagggcgaggaaggtgtctatgcactcactcagtacctcatagacgccttc
ggaagccgctttgacttcgagtacaggatagcagtcgttggtcctgccgcgctgaacact
aactacggaggcatattctctcaggcgttgaggaagggcaagcgtctcgtgggtagtgag
gactgggcggctcgtggaggttcaggaagcgttctgctcagggctcataacgtcatcgga
attatcttcggcggcaagccgaggaagaggaagttcccgggcgaggacatctcgaacttc
aaaaccgccaaggagatagtcgagggtgtccacaagaagccctacaacgagattattgcc
gagaaaacggtcaagtacaggtacaaccccaagctaaaaacggggggaacttttggaggc
aactatccggccgagggcgacttcgtcccgattctcaactggcagatgccctacatcccg
aaagaggaccgcataaaaatccatgagaacataatgaagcactactgggagcccttcaac
gaggaggcaataaagcccaagaactggacgacctgtggtgagccctgtcctgtggtctgt
aagaagtatgccaatggccaccacattgagtacgaaccgagggaagccaacggcccgctc
agcggcgtcataaccctccgggccagtgacataagtgttcctgcagtggatgctatgggc
ttcgacgcgatagagttcggtggaacggcagcgtgggttcttgagctgatccaccgcgac
ctgctcaaacctgaggaggttggcctcagtggtaagcctgagtttacgaaggacgcttta
atcgaacgccccgttgagacgagcgaggtcaacgccaagctcgtggcagagctggcccac
cgcgtggccttcggcgagaacgagattgctaaaatactcggcctcggcaagaggaaggcg
agcgtaatcttcgacgagcgctttaaggacaggctcaagtacggcgagagcttcaaggac
tacgcggtcttcactccgcttggcgaggacggcgagattacgccgacgatgtactgggcg
ataggcaactacatcccgctcccgattcagggtcgttactggaccttctaccagttcggc
gtcttcctcgagccggaggagctcgcccaaaagataatcgcttcagctctctgggagttc
tggtacgacaacgtcggctggtgccgcttccataggggctggatgaagccagtgctcaag
gccctgttcatggacgcctatgggataaacatcgacatggaggagcacgcgaaaaagcag
atcaagaggctcatcgagtacgcgaggaaagccggttatgtcccagtcttctgggacagc
atgcgcgtcatagacctcgttgcagcgggcagtgaggagttcggaaacgaaaagtgggcc
gagaagttcaggctcgacaaggtcggcacggccaaggagtatctgagcaaagtcttggat
gcctacagcgagattttgggggttgagtggaggctctga

DBGET integrated database retrieval system