KEGG   Thermococcus gammatolerans: TGAM_0122Help
Entry
TGAM_0122         CDS       T00920                                 

Gene name
gor
Definition
glyceraldehyde-3-phosphate (GAP):ferredoxin oxidoreductase (gor) (EC:1.2.7.5)
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGAM_0122 (gor)
   01230 Biosynthesis of amino acids
    TGAM_0122 (gor)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0122 (gor)
Enzymes [BR:tga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     TGAM_0122 (gor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(113443..115401)
Genome map
AA seq 652 aa AA seqDB search
MRFTVLKLKLDENRVESEEFEKDDVYGVIDYGLELHESLETHSIDPYDPRNIIVMGMGPF
AGSVLPGAHRLMFFFRSPLYGTLFPSAMGGAAYAFKNVGVDFVTFEGKAEKPVVVLLYND
GESVRVELHEVELEKVIEVWRGYKGEEGVYALTQYLIDAFGSRFDFEYRIAVVGPAALNT
NYGGIFSQALRKGKRLVGSEDWAARGGSGSVLLRAHNVIGIIFGGKPRKRKFPGEDISNF
KTAKEIVEGVHKKPYNEIIAEKTVKYRYNPKLKTGGTFGGNYPAEGDFVPILNWQMPYIP
KEDRIKIHENIMKHYWEPFNEEAIKPKNWTTCGEPCPVVCKKYANGHHIEYEPREANGPL
SGVITLRASDISVPAVDAMGFDAIEFGGTAAWVLELIHRDLLKPEEVGLSGKPEFTKDAL
IERPVETSEVNAKLVAELAHRVAFGENEIAKILGLGKRKASVIFDERFKDRLKYGESFKD
YAVFTPLGEDGEITPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELAQKIIASALWEF
WYDNVGWCRFHRGWMKPVLKALFMDAYGINIDMEEHAKKQIKRLIEYARKAGYVPVFWDS
MRVIDLVAAGSEEFGNEKWAEKFRLDKVGTAKEYLSKVLDAYSEILGVEWRL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcacggttctcaaactcaagctggacgaaaacagagttgagagcgaggagttt
gagaaggacgacgtctacggcgtcatagattacggtcttgagcttcacgaaagccttgag
acccattccatcgacccctacgatcctcggaacatcattgttatgggcatggggcccttt
gcgggctcggttcttcccggagcgcatagattgatgttcttcttccgctcaccgctctac
ggcacactctttccctcggcaatgggtggtgccgcctacgccttcaagaacgtcggcgtt
gatttcgtgacctttgagggcaaggccgagaagcccgtcgtggttctcctctacaacgat
ggtgagagcgtaagggtcgagctccacgaggttgagcttgaaaaggtcatagaggtctgg
aggggctacaagggcgaggaaggtgtctatgcactcactcagtacctcatagacgccttc
ggaagccgctttgacttcgagtacaggatagcagtcgttggtcctgccgcgctgaacact
aactacggaggcatattctctcaggcgttgaggaagggcaagcgtctcgtgggtagtgag
gactgggcggctcgtggaggttcaggaagcgttctgctcagggctcataacgtcatcgga
attatcttcggcggcaagccgaggaagaggaagttcccgggcgaggacatctcgaacttc
aaaaccgccaaggagatagtcgagggtgtccacaagaagccctacaacgagattattgcc
gagaaaacggtcaagtacaggtacaaccccaagctaaaaacggggggaacttttggaggc
aactatccggccgagggcgacttcgtcccgattctcaactggcagatgccctacatcccg
aaagaggaccgcataaaaatccatgagaacataatgaagcactactgggagcccttcaac
gaggaggcaataaagcccaagaactggacgacctgtggtgagccctgtcctgtggtctgt
aagaagtatgccaatggccaccacattgagtacgaaccgagggaagccaacggcccgctc
agcggcgtcataaccctccgggccagtgacataagtgttcctgcagtggatgctatgggc
ttcgacgcgatagagttcggtggaacggcagcgtgggttcttgagctgatccaccgcgac
ctgctcaaacctgaggaggttggcctcagtggtaagcctgagtttacgaaggacgcttta
atcgaacgccccgttgagacgagcgaggtcaacgccaagctcgtggcagagctggcccac
cgcgtggccttcggcgagaacgagattgctaaaatactcggcctcggcaagaggaaggcg
agcgtaatcttcgacgagcgctttaaggacaggctcaagtacggcgagagcttcaaggac
tacgcggtcttcactccgcttggcgaggacggcgagattacgccgacgatgtactgggcg
ataggcaactacatcccgctcccgattcagggtcgttactggaccttctaccagttcggc
gtcttcctcgagccggaggagctcgcccaaaagataatcgcttcagctctctgggagttc
tggtacgacaacgtcggctggtgccgcttccataggggctggatgaagccagtgctcaag
gccctgttcatggacgcctatgggataaacatcgacatggaggagcacgcgaaaaagcag
atcaagaggctcatcgagtacgcgaggaaagccggttatgtcccagtcttctgggacagc
atgcgcgtcatagacctcgttgcagcgggcagtgaggagttcggaaacgaaaagtgggcc
gagaagttcaggctcgacaaggtcggcacggccaaggagtatctgagcaaagtcttggat
gcctacagcgagattttgggggttgagtggaggctctga

DBGET integrated database retrieval system