KEGG   Thermococcus gammatolerans: TGAM_0123Help
Entry
TGAM_0123         CDS       T00920                                 

Gene name
fbp
Definition
(RefSeq) Fructose-1,6-bisphosphatase (FBPase V) (fbp) (EC:3.1.3.11)
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGAM_0123 (fbp)
   01230 Biosynthesis of amino acids
    TGAM_0123 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0123 (fbp)
   00030 Pentose phosphate pathway
    TGAM_0123 (fbp)
   00051 Fructose and mannose metabolism
    TGAM_0123 (fbp)
  Energy metabolism
   00680 Methane metabolism
    TGAM_0123 (fbp)
Enzymes [BR:tga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TGAM_0123 (fbp)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TGAM_0123 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(115537..116664)
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITISVIKADIGGWPGHSRVHPQLIETAEEILAKAKEEGTIIDFYVAYAGDDLQL
IMTHKKGVDSPDVHGLAWKAFEEATKVAKELGLYGAGQDLLKDAFSGNVRGMGPGVAEME
ITLRKSEPVVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEVWDILKHK
RVILNTPEEVYDLLALIGAKSRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITDYMRRHGPFEPHRLPLEDMEYTTL
PGVLKRLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgttggagagaaaataacgattagcgtgattaaggctgacatcggtggctggccg
gggcactccagggtgcacccccagctcatagagaccgccgaggagattctcgccaaggcc
aaggaagaagggacgataatcgacttctacgtggcttacgcgggtgacgacctccagctg
atcatgacccacaagaaaggcgttgacagccccgatgttcacggactggcctggaaggcc
ttcgaggaagcaaccaaggtcgccaaggagcttggcctctacggcgccggacaggacctc
ctcaaggatgcattcagcggaaacgtccgcggaatgggcccgggcgttgcggagatggag
attaccctgaggaagagcgagccggttgtgaccttccacatggacaagactgagcctgga
gccttcaacctgccgatattcaggatgttcgccgacccgttcaacaccgctggcctggtc
atcgaccccaagatgcacatgggcttccgcttcgaggtctgggacatcctcaagcacaag
cgcgtcatcctcaacacccccgaggaggtctacgaccttcttgcactcataggggcaaag
agccgctacgtcatcaagcgcgtttacccgaaggagggccacccaattccgaaggacgag
ccggtagctgtggtcagcactgagaagctctacgagattgctggagaatacgtgggcaag
gacgacccggtcgctatagtcagggcccagagcggccttccggcccttggagaagtcctt
gagcccttcgccttcccgcacctcgtcagcggctggatgaggggttcgcacaacggaccg
ataatgccagttccgatgcaccaggccaatccgaccaggttcgacggtccgccgagggtt
gtcgctctaggctggcagataagcccagaaggaaagctcgtcggtcccgttgatctcttc
gacgacccggccttcgactacgccaggcagaaggcccttgagataacggattatatgcgc
aggcacggtccgttcgagccacaccgcctgccactcgaggatatggaatacaccaccctg
cccggcgtgttgaagaggcttgaggagcgctttgaggacattgagtga

DBGET integrated database retrieval system