KEGG   Thermococcus gammatolerans: TGAM_0123Help
Entry
TGAM_0123         CDS       T00920                                 

Gene name
fbp
Definition
(GenBank) Fructose-1,6-bisphosphatase (FBPase V) (fbp)
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tga  Thermococcus gammatolerans
Pathway
tga00010  Glycolysis / Gluconeogenesis
tga00030  Pentose phosphate pathway
tga00051  Fructose and mannose metabolism
tga00680  Methane metabolism
tga01100  Metabolic pathways
tga01110  Biosynthesis of secondary metabolites
tga01120  Microbial metabolism in diverse environments
tga01130  Biosynthesis of antibiotics
tga01200  Carbon metabolism
tga01230  Biosynthesis of amino acids
Module
tga_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0123 (fbp)
   00030 Pentose phosphate pathway
    TGAM_0123 (fbp)
   00051 Fructose and mannose metabolism
    TGAM_0123 (fbp)
  Energy metabolism
   00680 Methane metabolism
    TGAM_0123 (fbp)
Enzymes [BR:tga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TGAM_0123 (fbp)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TGAM_0123 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ACS32625
UniProt: C5A313
Position
complement(115537..116664)
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITISVIKADIGGWPGHSRVHPQLIETAEEILAKAKEEGTIIDFYVAYAGDDLQL
IMTHKKGVDSPDVHGLAWKAFEEATKVAKELGLYGAGQDLLKDAFSGNVRGMGPGVAEME
ITLRKSEPVVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEVWDILKHK
RVILNTPEEVYDLLALIGAKSRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITDYMRRHGPFEPHRLPLEDMEYTTL
PGVLKRLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgttggagagaaaataacgattagcgtgattaaggctgacatcggtggctggccg
gggcactccagggtgcacccccagctcatagagaccgccgaggagattctcgccaaggcc
aaggaagaagggacgataatcgacttctacgtggcttacgcgggtgacgacctccagctg
atcatgacccacaagaaaggcgttgacagccccgatgttcacggactggcctggaaggcc
ttcgaggaagcaaccaaggtcgccaaggagcttggcctctacggcgccggacaggacctc
ctcaaggatgcattcagcggaaacgtccgcggaatgggcccgggcgttgcggagatggag
attaccctgaggaagagcgagccggttgtgaccttccacatggacaagactgagcctgga
gccttcaacctgccgatattcaggatgttcgccgacccgttcaacaccgctggcctggtc
atcgaccccaagatgcacatgggcttccgcttcgaggtctgggacatcctcaagcacaag
cgcgtcatcctcaacacccccgaggaggtctacgaccttcttgcactcataggggcaaag
agccgctacgtcatcaagcgcgtttacccgaaggagggccacccaattccgaaggacgag
ccggtagctgtggtcagcactgagaagctctacgagattgctggagaatacgtgggcaag
gacgacccggtcgctatagtcagggcccagagcggccttccggcccttggagaagtcctt
gagcccttcgccttcccgcacctcgtcagcggctggatgaggggttcgcacaacggaccg
ataatgccagttccgatgcaccaggccaatccgaccaggttcgacggtccgccgagggtt
gtcgctctaggctggcagataagcccagaaggaaagctcgtcggtcccgttgatctcttc
gacgacccggccttcgactacgccaggcagaaggcccttgagataacggattatatgcgc
aggcacggtccgttcgagccacaccgcctgccactcgaggatatggaatacaccaccctg
cccggcgtgttgaagaggcttgaggagcgctttgaggacattgagtga

DBGET integrated database retrieval system