KEGG   Thermococcus gammatolerans: TGAM_0230Help
Entry
TGAM_0230         CDS       T00920                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tga  Thermococcus gammatolerans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGAM_0230 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_0230 (acsA)
   00620 Pyruvate metabolism
    TGAM_0230 (acsA)
   00640 Propanoate metabolism
    TGAM_0230 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TGAM_0230 (acsA)
   00680 Methane metabolism
    TGAM_0230 (acsA)
Enzymes [BR:tga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TGAM_0230 (acsA)
Lipid biosynthesis proteins [BR:tga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TGAM_0230 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(221139..223079)
Genome map
AA seq 646 aa AA seqDB search
MQIGEGFLKERYLPLRAFREEHRKSIENIEEFWAEQAKVLDWFKTWDRVLDDSKAPFFRW
FVGGQLNASYNALDRHVKAGKRNRAAIIWESERGETRTLTYYELYREVNRFASALKNLGV
GKGDRVVIYMPLVPEVVIAMLASARIGAIHSVVFSGFSAEALATRINDARAKVVITADYL
YRRGKKLNLKEIVDRALLETPSVESVVVLRREENGVNMVEGRDYDWHNLLEGADKYVEPV
PVESNHPLFILYTSGTTGKPKGIVHSTGGYLVYVAKTMQWAWGITESDLFWNTADVGWIT
GHSYLVYGPLTLGLTVMMYEGALNYPKPDRPWELIEKHGVTIFYTAPTAIRMLMRYGDEW
VKKHDLSSLRLLGSVGEPINPRAWKWYYEVVGGGRCPIIDTWWQTETGGYMIYPSAGLQL
PPLKPGSATFPGLGVDADVLRADGSPAEPNERGYLVIKKPWPGMLLGIWGDDERYIRTYW
QRFSKPDEGIWIYYPADYAMKDDEGYFWIFGRADEVLNVSGHRIGTAEIEHALVLHPAVA
EAAVIGRPDEIKGEVPVAFVILKENVVPSEGLKKELIDYVRETLGPIAAPAEVFFVNKLP
KTRSGKIMRRVLKALASGKGLGDLSTLEDEASVEEVKKALEGFEMR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcagataggcgagggattcctcaaagaaaggtacctaccgttgcgggccttcagggag
gagcacaggaagtccatagagaacatcgaggagttctgggccgagcaggcgaaggtactt
gactggttcaagacctgggacagggttcttgatgactcaaaggcgcccttcttccgctgg
ttcgtcgggggccagctcaacgcgagctacaacgccctcgacaggcacgttaaggcagga
aagagaaaccgcgccgcgataatctgggagagcgagcgcggtgagacgagaacgctgacc
tactacgagctctaccgcgaggttaaccgctttgcttccgctctgaaaaacctcggcgta
ggaaagggcgacagggtcgtcatctacatgcccctcgttccagaggtcgtcatagcaatg
ctcgccagcgcgagaataggggcgattcacagcgtcgtcttctcgggcttctcggcggaa
gccttagcaacgagaatcaacgacgcaagggcaaaggtggttatcacggcagattacctc
tacaggcgcggtaagaagctcaacctcaaggagatagttgacagggcccttctcgaaacg
ccgagcgttgagagcgtcgtcgtcctcaggagggaagagaacggcgtcaacatggtcgag
ggcagggactacgactggcataacctccttgagggggcggataagtacgttgagcccgtc
cccgttgagagcaaccacccgctgttcatcctatacacgagcggaacaaccggaaagccc
aagggtatcgttcactccacaggcggctacctcgtctacgtggccaagaccatgcagtgg
gcttgggggataaccgagagcgacctcttctggaacaccgccgacgtcggctggattacg
ggccacagttacctcgtctacgggcctttaaccctcggcctgaccgtgatgatgtacgag
ggagctctcaactatccaaagccagacaggccctgggagctgatagagaagcacggggtg
acgatattctacaccgcgccaacagccatcaggatgctcatgcgctacggggacgagtgg
gtgaagaagcacgacctctcaagtttaaggctcctcggttcggtcggcgagccgataaat
ccaagggcctggaagtggtactacgaggtcgtgggcggtggaaggtgcccgataatcgac
acctggtggcaaaccgagaccggtggctacatgatttacccctccgccgggctacagttg
cccccgctgaagccaggctccgcgacgttccccggcctcggcgtcgatgcggacgttctc
agggccgatggaagccctgcagagccgaacgagcgcggctatctcgtgataaagaagccc
tggccagggatgctcctcggaatctggggcgacgatgagcgctacataagaacttattgg
cagaggttcagcaagcccgatgagggaatctggatttactaccccgcggattatgcgatg
aaggacgatgagggctacttctggatattcggcagggccgacgaggtgctgaacgtttcg
ggtcacaggattggaacggccgagatagagcatgcattggttctccacccagccgttgca
gaagcggcggtaatcggcaggccagacgagattaagggtgaggtgccagttgccttcgta
atcctcaaggagaacgtcgtcccgagtgagggcctgaagaaggagctcatagactacgtc
agggaaaccctcggcccaatagcggccccagcggaagtgttcttcgttaacaaactgccg
aagacgaggagcgggaagataatgcgcagggttctaaaggccctcgccagtggaaagggc
ctcggcgacctctcgacgctcgaagacgaggcgagcgtggaagaggtgaaaaaggctctt
gaaggctttgagatgcgctga

DBGET integrated database retrieval system